KEGG   Bos indicus (zebu cattle): 109563195
Entry
109563195         CDS       T04792                                 

Gene name
IL11RA
Definition
(RefSeq) interleukin-11 receptor subunit alpha
  KO
K05056  interleukin 11 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109563195 (IL11RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109563195 (IL11RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109563195 (IL11RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109563195 (IL11RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL6/12 receptor family
   109563195 (IL11RA)
SSDB
Motif
Pfam: fn3 Ig_3 EpoR_lig-bind Ig_2 ig
Other DBs
NCBI-GeneID: 109563195
NCBI-ProteinID: XP_019822013
UniProt: A0A6P5C952
LinkDB
Position
8
AA seq 422 aa
MSSSCSGLSRVLVAVAAALVSASSPCPQAWGPPGVQYGQLGRALMLCCPGVTAGAPVSWX
RDGETRLLQGPASGLGPKLVLARAESTDEGTYTCRTLDGALRGMVTLRLGYPPARPVVSC
RAADYENFSCTWSPSQVSGLPTRYLTSYRKKTVPGADGQRMSPSTGPWPCLQDPPGAARC
IVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHVVRVSARDFLD
AGTWSSWSPEAWGTPSTEPLPKEMPVGDQQHTQTEEEPQADSPAPPKPSLLPDPQPLDHR
DPLEQVAVLASLGIFSFLGLVAGALALGLWLRLRPDEKDGPQKSGLLAPMISVDKLPGVP
NL
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgagcagcagctgctcagggctgagcagggtcctggtggccgtggctgcagccctggtg
tctgcctcctctccctgcccccaggcctggggccccccaggggtccagtatgggcagctt
ggcagggccctgatgctgtgttgccctggagtgactgctggggccccggtgtcctggytt
cgggacggggagacaaggctgctccagggacctgcctctgggctagggcccaaactggtc
ctggcccgagcagaaagcactgacgagggcacctatacctgccggaccctggacggtgca
cttaggggcatggtgaccctgcggctaggctaccccccggcccgccccgttgtttcctgc
cgggctgctgactatgagaacttctcctgcacttggagtcccagccaggttagcggttta
cccacccgctacctcacctcctacaggaagaagactgtgccgggagctgatggccaaagg
atgagcccatccacagggccctggccatgcttacaggacccccctggggcggcccgctgt
atagtccatggggcagagttctggagccagtatcggatcaatgtgactgaagtgaacccc
ctgggggccagcacccgcctgctggatgtgagcttgcagagcatcttgcgccctgacccg
ccccagggcctgcgggtagagtcagtgcctggctatcctcgccgcctgcgtgctagctgg
acataccctgcctcctggccccgccagccccacttcctgctcaagttccgtctgcagtac
cgtccagcacagcatccagcctggtctacggtggagccagctggattggaggaggtgatc
accgatgctgtggctgggctgccccatgtagtgcgggtcagcgcccgggactttctggat
gctggcacctggagctcctggagccccgaggcctgggggactccaagcactgagccccta
ccgaaggagatgccagttggggaccagcaacacacacagacagaggaagaacctcaggca
gacagccccgctcccccaaagccgtcccttctacccgacccacagccacttgaccacaga
gaccccctggagcaggtggccgtgctggcatctttgggaatcttctctttcctgggactg
gtggctggggccctggcattggggctctggctaaggttgagaccagatgagaaggatgga
ccccaaaaatctgggctcttggccccaatgatttcagtggacaagcttccaggagtccca
aacctgtag

DBGET integrated database retrieval system