KEGG   Bos indicus (zebu cattle): 109563503
Entry
109563503         CDS       T04792                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04213  Longevity regulating pathway - multiple species
biu04330  Notch signaling pathway
biu04613  Neutrophil extracellular trap formation
biu04919  Thyroid hormone signaling pathway
biu05016  Huntington disease
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109563503 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109563503 (HDAC2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109563503 (HDAC2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109563503 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109563503 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109563503 (HDAC2)
   05202 Transcriptional misregulation in cancer
    109563503 (HDAC2)
   05206 MicroRNAs in cancer
    109563503 (HDAC2)
   05203 Viral carcinogenesis
    109563503 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109563503 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109563503 (HDAC2)
  09165 Substance dependence
   05031 Amphetamine addiction
    109563503 (HDAC2)
   05034 Alcoholism
    109563503 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109563503 (HDAC2)
   05165 Human papillomavirus infection
    109563503 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109563503 (HDAC2)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109563503 (HDAC2)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109563503 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     109563503 (HDAC2)
    BRAF-HDAC complex
     109563503 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109563503 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    109563503 (HDAC2)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 109563503
NCBI-ProteinID: XP_019822460
UniProt: A0A6P5CA61
LinkDB
Position
9
AA seq 493 aa
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPVSITIFSKPFWLSKILFIFKNFSFXAVTVCKCIVTQIFFVLGHAKCVEVVKTFNLP
LLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQN
TPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRI
ACDEEFSDSEDEGEGGRRNVTDHKKGAKKARIEEDKKETEDKKADVKEEDKSKDNSGEKT
DTKGAKSEQLSNP
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaagaagaaagtctgctactactatgatggtgatatt
ggaaattattattacggacagggtcatcccatgaaacctcataggatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggagatatataggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctacgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgtcggagaggac
tgtccagtgtttgatggactttttgaattttgtcagctttcaactggtggctcagttgct
ggtgctgtgaaattaaacagacaacaaactgatatggctgttaactgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttatgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatattgatatccatcat
ggtgatggtgttgaggaggctttttatacaacagatcgtgtaatgactgtatcattccat
aagtatggggaatactttcctggaacaggagacttaagggatattggtgcaggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgaatcatatggccag
atatttaagcctgtaagtattactattttttcaaagccattttggttgagtaaaattttg
tttatatttaaaaatttttcttttycagctgttacagtgtgtaaatgtattgttacccaa
atcttctttgtcttaggtcatgctaaatgtgtagaagttgtaaaaactttcaatttacca
ttactgatgcttgggggaggtggatacacaatccgcaacgttgctcggtgttggacatat
gagactgcagttgcccttgattgtgagattcccaacgaattgccatataatgattatttt
gagtattttggaccggacttcaaactgcatattagtccttcaaacatgacaaaccagaac
actccagaatatatggaaaagataaaacagcgtttatttgaaaatttacgcatgttgcct
catgcacctggcgtccagatgcaagctattccagaagatgcagttcatgaagatagtgga
gatgaagatggagaagatccagacaagagaatttctattcgagcatcagacaaacgaata
gcttgtgatgaagagttctcagattctgaggacgaaggagaaggcggtcgtagaaatgtg
actgatcataagaaaggagcaaaaaaagctagaatcgaagaagacaagaaggaaacggag
gacaaaaaagcagatgttaaggaggaagataaatccaaggataatagtggtgaaaaaaca
gataccaaaggagccaaatcagaacagctcagcaatccttga

KEGG   Bos indicus (zebu cattle): 109572356
Entry
109572356         CDS       T04792                                 

Gene name
HDAC1
Definition
(RefSeq) histone deacetylase 1 isoform X1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04213  Longevity regulating pathway - multiple species
biu04330  Notch signaling pathway
biu04613  Neutrophil extracellular trap formation
biu04919  Thyroid hormone signaling pathway
biu05016  Huntington disease
biu05031  Amphetamine addiction
biu05034  Alcoholism
biu05165  Human papillomavirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05203  Viral carcinogenesis
biu05206  MicroRNAs in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109572356 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109572356 (HDAC1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    109572356 (HDAC1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109572356 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    109572356 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572356 (HDAC1)
   05202 Transcriptional misregulation in cancer
    109572356 (HDAC1)
   05206 MicroRNAs in cancer
    109572356 (HDAC1)
   05203 Viral carcinogenesis
    109572356 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109572356 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109572356 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    109572356 (HDAC1)
   05034 Alcoholism
    109572356 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109572356 (HDAC1)
   05165 Human papillomavirus infection
    109572356 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:biu03036]
    109572356 (HDAC1)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109572356 (HDAC1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     109572356 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     109572356 (HDAC1)
    BRAF-HDAC complex
     109572356 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109572356 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    109572356 (HDAC1)
SSDB
Motif
Pfam: Hist_deacetyl
Other DBs
NCBI-GeneID: 109572356
NCBI-ProteinID: XP_019834654
UniProt: A0A6P5DB38
LinkDB
Position
2
AA seq 482 aa
MAQTQGTKRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEEDPDKRISICSSDKRIACEEEF
SDSDEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKQEAKGVKEEVK
LA
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggcgcagactcagggcaccaagaggaaagtctgttactattacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttactccttaactatggtctctaccggaagatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagtgatgactacattaaattcttacgctccatccgc
ccagataacatgtccgagtacagcaagcagatgcagagattcaacgtcggtgaggactgt
cccgtatttgatggcctgtttgagttctgtcagctgtctactggtggctctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctacac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtatattgacattgatattcaccacggc
gatggcgtggaagaggccttctataccacagaccgagtcatgactgtgtcctttcataaa
tatggagagtacttcccaggaactggggacctacgggatattggagctggcaaaggcaag
tattatgctgttaactaccctctccgagatgggattgacgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcccagtgcagttgtcttgcag
tgtggctctgactccttgtctggggatcggttaggttgcttcaatctgaccatcaaaggg
catgccaagtgtgtggaatttgtgaagagcttcaacctgcctatgctgatgctgggagga
ggtggctacaccattcgtaatgtcgcccggtgctggacatatgaaacagctgtggccctg
gacacggagatccctaatgagcttccatacaacgactacttcgaatactttggaccagat
ttcaaacttcatatcagtccttccaatatgactaaccagaacactaatgagtacctggaa
aagatcaaacagcggctgttcgagaacctgagaatgctgccccacgcgcctggggtccag
atgcaggccatccccgaggacgccattccagaggagagtggtgatgaggatgaagaagac
cctgacaagcgcatctcaatctgttcctcggacaaacgaattgcctgtgaggaagagttc
tccgactctgacgaggagggagaaggcgggcgcaagaactcttccaacttcaagaaagcc
aagagagtcaaaacagaggatgagaaagagaaagatccagaagagaagaaagaagtcaca
gaagaggagaaaaccaaggaagagaagcaagaagccaaaggggtcaaggaagaggtcaag
ttggcctga

DBGET integrated database retrieval system