KEGG   Bos indicus (zebu cattle): 109563564
Entry
109563564         CDS       T04792                                 

Gene name
KAT2B
Definition
(RefSeq) histone acetyltransferase KAT2B
  KO
K06062  histone acetyltransferase [EC:2.3.1.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04330  Notch signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109563564 (KAT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109563564 (KAT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109563564 (KAT2B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109563564 (KAT2B)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     109563564 (KAT2B)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     109563564 (KAT2B)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    109563564 (KAT2B)
   HAT complexes
    PCAF complex
     109563564 (KAT2B)
    STAGA complex
     109563564 (KAT2B)
    TFTC complex
     109563564 (KAT2B)
    SAGA complex
     109563564 (KAT2B)
    SLIK complex
     109563564 (KAT2B)
    ADA-HAT complex
     109563564 (KAT2B)
    HAT-A2 complex
     109563564 (KAT2B)
    ATAC complex
     109563564 (KAT2B)
SSDB
Motif
Pfam: PCAF_N Bromodomain Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Other DBs
NCBI-GeneID: 109563564
NCBI-ProteinID: XP_019822500
UniProt: A0A6P5CA93
LinkDB
Position
1
AA seq 826 aa
MLRSLDLRDPPSVFLSQHHPSLTACALCSPVLPVRRXQRPRGCSPGPGRVSLAPSIPGKR
SRQRVDPRCLSSGPTGDWEEPAREWEEPAGEWEELAEESCKCNGWKNPNPSPTPPRADLQ
QIIVSLTESCRSCSHALAAHVSHLENVSEEEMNRLLGIVLDVEYLFTCVHREEDADTKQV
YFYLFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPPKERQTIVE
LAKMFLNRINYWHLEAPSQRRLRSPNDDISGYKENYTRWLCYCNVPQFCDSLPRYETAQV
FGRTLLRSVFTVMRRQLLEQARQEKDKLPLEKRTLILTHFPKFLSMLEEEVYSQNSPIWD
QDFLSASSRTSQLGIQTVISPPPVAGTVSYNSSSASLEQQNGGSASPSCRGASGLEANPG
EKRKMNESHVLEETKKPRVMGDIPLELIHEVMSTITDPTAMLGPETNFLSAHSARDEAAR
LEERRGVIEFHVVGNSLSQKPNKKVLMWLVGLQNVFSHQLPRMPKEYITRLVFDPKHKTL
ALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHDILNFL
TYADEYAIGYFKKQGFSKEIKIPKTKYVGYIKDYEGATLMGCELNPRIPYTEFSVIIKKQ
KEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIPGIRETGWKPSGRERSKEARDPD
QLYSTLRSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKK
LFMADLQRVFTNCKEYNPPESEYYKCASILEKFFFSKIKEAGLIDK
NT seq 2481 nt   +upstreamnt  +downstreamnt
atgctgcggtctcttgaccttcgtgacccgccgtctgtctttctctcccagcaccacccc
tctctgacagcctgtgcgctgtgctcacctgtgctgcccgtccgccgtycccagcgcccc
cgcggctgctcccccgggcccggcagggtctccttggctccttccatacccggcaaacgt
agccggcagagagtagaccctcggtgcctgtcctcagggcccacgggggactgggaggag
ccggcaagggagtgggaggagcccgcgggggagtgggaggagctggcagaggaatcttgt
aaatgcaatggctggaaaaaccccaatccttcgcccacgccccccagagccgacctgcag
cagatcatcgtcagcctgacggagtcctgccggagctgcagccatgccctcgctgctcac
gtgtcgcatctggagaacgtgtcggaggaggagatgaacagactgctgggcatcgtgctg
gatgtggagtatctctttacctgcgtccacagggaagaagatgccgacaccaagcaggtt
tatttctacctgttcaagctcttgaggaagtctattttacaaagaggaaaacctgtggtt
gaaggttctttggagaagaagcccccttttgaaaaacctagtattgaacagggtgtgaat
aactttgtacagtacaaattcagtcacctgccacccaaagaaaggcaaacgatcgttgag
ctggcaaaaatgttcctgaaccgtatcaactattggcatctggaggcaccatctcagcga
agactgcgctctcccaacgatgacatctctgggtacaaggagaactacaccaggtggctg
tgttactgcaacgttccccagttctgcgacagcctgccgcggtacgagacggcccaggtg
ttcgggaggacgctgctgcgctccgtcttcactgtgatgcggcggcagctgctggagcag
gcgaggcaggagaaggacaaactgccgctggagaagcggactctgatcctcacacacttc
ccgaagtttctgtccatgttagaagaagaagtttatagtcaaaactctcccatctgggat
caggattttctctcagcttcttccagaaccagccagcttggaatccaaacagttatcagt
ccacctcccgtggccgggacagtttcctacaattcaagctccgcttcccttgaacagcag
aacggagggagcgccagtccgtcctgtcgaggcgcgtccgggcttgaggcaaacccagga
gaaaagaggaaaatgaacgagtctcatgttttggaggagaccaagaagccccgggtgatg
ggcgatatcccactggagttaatccacgaggtcatgtccaccatcacagaccccaccgcg
atgcttgggccagagaccaactttctgtcggcgcactcggccagggacgaggcggccagg
cttgaggagcggaggggtgtaatcgagttccacgtggtgggcaactccctgagccagaag
cccaacaagaaggtgctcatgtggctggtagggctgcagaacgtgttctcgcaccagctg
ccgcgtatgcccaaggagtacatcacccggctcgtcttcgacccgaaacacaaaaccctt
gctttaatcaaagatggccgtgtcattggcggtatctgcttccggatgttcccgtcccag
ggcttcacagagattgtyttctgcgctgtaacctctaacgaacaagtcaagggctatgga
acacacctgatgaaccacttgaaggaataccacataaaacacgacatcctgaacttcctc
acctacgcagatgaatacgcaattggatatttcaagaagcagggtttctccaaagaaatt
aaaatccctaaaaccaaatatgttggctacatcaaggattaygaaggcgccactttaatg
ggatgtgagctaaatccacggatcccatacacggagttctctgtcatcattaagaagcag
aaggagatcattaaaaagctgatagaaagaaaacaagcccagattcggaaagtctacccg
ggactttcctgttttaaagatggagttcggcagatcccgatagaaagcattcctggaatt
cgagagacaggctggaagccgagtggaagagagagaagtaaagaggccagagaccccgac
cagctgtacagcacgctcaggagcatcctgcagcaggtgaagagccatcaaagcgcttgg
cccttcatggaacccgtgaagagaacagaagctccgggatattatgaagttataaggttc
cccatggatctgaaaaccatgagtgaacgcctcaagaataggtactacgtgtctaagaaa
ctgttcatggcagatttacagcgagtctttaccaattgcaaagagtacaacccccctgag
agtgaatactacaaatgtgccagtatcctggagaaattcttcttcagtaaaattaaggaa
gctggattaattgacaagtga

DBGET integrated database retrieval system