KEGG   Bos indicus (zebu cattle): 109563845
Entry
109563845         CDS       T04792                                 

Gene name
FOXO3
Definition
(RefSeq) LOW QUALITY PROTEIN: forkhead box protein O3
  KO
K09408  forkhead box protein O3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04062  Chemokine signaling pathway
biu04068  FoxO signaling pathway
biu04137  Mitophagy - animal
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04218  Cellular senescence
biu04722  Neurotrophin signaling pathway
biu04917  Prolactin signaling pathway
biu05213  Endometrial cancer
biu05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109563845 (FOXO3)
   04151 PI3K-Akt signaling pathway
    109563845 (FOXO3)
   04152 AMPK signaling pathway
    109563845 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109563845 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    109563845 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    109563845 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109563845 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109563845 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    109563845 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    109563845 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    109563845 (FOXO3)
   05223 Non-small cell lung cancer
    109563845 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109563845 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109563845 (FOXO3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    109563845 (FOXO3)
SSDB
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Other DBs
NCBI-GeneID: 109563845
NCBI-ProteinID: XP_019822819
UniProt: A0A6P5CBT1
LinkDB
Position
9
AA seq 672 aa
MAEAPASPAPISPLEVELDPEFEPQSRPRSCTWPLQRPELQGSPAKPSGEAAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGGPLGSGLLLEDSARLLAPGGQDPGSGPAPAAGALSG
GTQTPLQPQQPLPPPXPGTAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTLS
QIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGG
KSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSSD
ELDAWTDFRSRTNSNASTVSGRLSPILASTELDDVQDDDAPLSPMLYSSSASLSPSVSKP
CTVELPRLTDMAGTMNLNDGLADNLMDDLLDNIALPASQPSPPGGLMQRSSSFPYTTKGS
GLGSPTSSFSSAVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLSH
SDVMMTQSDPLMSQASTAVSAQNSRRNVMLRSDPMMSFAAQPNQGSLVNQNLLHHQHQTQ
GALGGSRALSNSVSNMGLSDSSSLGSAKHQQQSPVSQSMQTLSDSVSGSSLYSTSANLPV
MGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGSFTG
AKQASSQSWVPG
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggcagaggcgccggcctccccggccccgatctctccgctcgaagtggagctagacccg
gagttcgagccccagagccggccgcgctcctgtacgtggcccctgcagaggccggagctc
caggggagcccggccaagccctctggggaggcggctgctgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggtggcggtagggccggctcggccatggcgatcggc
ggcggcgggggcggcccgctgggctctgggttgctcctggaggactcggcccggctgctg
gctcctggagggcaggaccccgggtccgggccagcccccgcggcgggcgcgctgagcggg
gggacgcagacaccgctgcagcctcagcagccactgccaccgccttagccggggacggct
gggggctctgggcagccgaggaaatgctcgtcgcggaggaacgcctgggggaacctgtcc
tacgccgatctgatcactcgcgcgatcgagagctctccagacaaacggctcactctgtcc
cagatctatgagtggatggtgcgctgcgtgccctacttcaaggataagggcgacagcaac
agctctgccggctggaagaactctatccggcacaacctgtcactgcacagccggttcatg
cgggtccagaatgagggaaccggcaagagctcgtggtggatcatcaaccctgacggcggg
aagagtggcaaggcgccccggcggcgggccgtctccatggacaacagcaacaagtacacc
aagagccgcggccgtgcagccaagaagaaggcagccctgcagaccgcccccgagtcagca
gatgacagtccctcccagctctccaagtggcccggcagccccacatcccgcagcagcgat
gagctggacgcgtggaccgacttccgctcgcgcaccaattccaacgccagcacagtcagc
ggccgcctgtcccccatcctggcgagcacggagctggacgacgtccaggacgatgatgca
ccactgtcccccatgctctatagcagctcggccagcctgtcgccctccgtcagcaagccg
tgcactgtggagctgccccggctgaccgacatggcgggcaccatgaatctgaacgacggg
ctggccgacaacctcatggacgacctgctggacaatatcgcgctccctgcatcccagcca
tcgcccccgggggggctcatgcagcgcagctccagcttcccgtacaccaccaagggctcc
ggcctgggctcccccaccagctccttcagcagcgcggtatttggtccctcgtctctgaac
tccctgcgccagtctcccatgcagaccatccaagagaacaagccagccaccttctcttcc
atgtcccactacggcaaccagacactccaggacctgctcacatcggactcactcagccac
agcgatgtcatgatgacccagtcggaccccttgatgtctcaggccagcaccgctgtgtcc
gcccagaactcccgccggaacgtgatgcttcgcagtgacccaatgatgtcctttgccgcc
cagcctaaccaggggagtttggtcaatcagaacttgctccaccaccagcaccaaacccag
ggcgctctcggtggcagccgtgccttgtcgaattccgtcagcaacatgggcttgagcgac
tccagcagcctcgggtcagccaaacaccagcaacagtctcccgtcagccagtctatgcaa
accctctcggactctgtctcaggctcctccttgtactcaaccagtgcgaaccttccagtc
atgggtcacgagaagttccccagcgacttggacctggacatgttcaatgggagcttggaa
tgtgacatggagtccattatccgtagcgaactcatggatgctgatgggttggattttaac
tttgattccctcatctccacacagaacgttgttggtttgaacgtggggagcttcactggt
gctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system