KEGG   Bos indicus (zebu cattle): 109563966
Entry
109563966         CDS       T04792                                 

Gene name
TBPL1
Definition
(RefSeq) TATA box-binding protein-like protein 1
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03022  Basal transcription factors
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109563966 (TBPL1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109563966 (TBPL1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109563966 (TBPL1)
   05017 Spinocerebellar ataxia
    109563966 (TBPL1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109563966 (TBPL1)
   05165 Human papillomavirus infection
    109563966 (TBPL1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    109563966 (TBPL1)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     109563966 (TBPL1)
  RNA polymerase III system
    TFIIIB
     109563966 (TBPL1)
  RNA polymerase I system
    SL1/TIF-1B
     109563966 (TBPL1)
SSDB
Motif
Pfam: TBP DUF3378
Other DBs
NCBI-GeneID: 109563966
NCBI-ProteinID: XP_019823023
UniProt: A0A6P5CC06
LinkDB
Position
9
AA seq 186 aa
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMKLRKPRITATI
WSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDFKVVNVLAVCNMPFEIRLPEF
TKNNRPHASYEPELHPAVCYRIKSLRATLQIFSTGSITVTGPNVKAVATAVEQIYPFVFE
SRKEIL
NT seq 561 nt   +upstreamnt  +downstreamnt
atggatgcagacagtgatgttgcactggacattctaattacaaatgtagtatgtgttttt
agaacaagatgccatttgaacttaaggaagattgctttagagggagcaaacgtaatttat
aagcgtgatgttggaaaagtattaatgaagcttagaaagcctagaattacagctacaatt
tggtcctcaggaaaaattatttgcactggagcaacaagtgaagaagaagctaaatttggt
gccagacgtttagcccgtagtctccagaaactaggatttcaggtaatatttacagatttt
aaggttgttaacgttttggcagtgtgtaacatgccgtttgaaatccgtttgccagaattc
acaaagaacaatagacctcatgccagttacgaacctgagcttcatcctgctgtgtgctat
cggataaaatcgctaagagctacattacagattttttcaacaggaagtatcacagtaaca
ggacccaatgtaaaggctgttgctactgctgtggaacagatttacccatttgtgtttgaa
agcaggaaagagattttataa

KEGG   Bos indicus (zebu cattle): 109564392
Entry
109564392         CDS       T04792                                 

Gene name
TBPL2
Definition
(RefSeq) TATA box-binding protein-like protein 2
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03022  Basal transcription factors
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109564392 (TBPL2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109564392 (TBPL2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109564392 (TBPL2)
   05017 Spinocerebellar ataxia
    109564392 (TBPL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109564392 (TBPL2)
   05165 Human papillomavirus infection
    109564392 (TBPL2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    109564392 (TBPL2)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     109564392 (TBPL2)
  RNA polymerase III system
    TFIIIB
     109564392 (TBPL2)
  RNA polymerase I system
    SL1/TIF-1B
     109564392 (TBPL2)
SSDB
Motif
Pfam: TBP
Other DBs
NCBI-GeneID: 109564392
NCBI-ProteinID: XP_019823420
UniProt: A0A6P5CCM2
LinkDB
Position
10
AA seq 341 aa
MEETYLELYLDQCSSQDALTPSRSPLLSPAVPYDVDMLTSSNPETAFNPQLEEVTEASGS
FSAVDLSFLPDELSQENKDQTVIRSKHEVEENCKTQSRQIRLPLPSQLDAGLALNSSSGS
GSHSHLHPADGNSXQPSPEKPHSMPLASITPMTPMAPISECSGIVPQLQNIVSTVNLACK
LDLKKIALHAKNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKY
ARVVQKLGFPARFLDFTIQNMVASCDVRFPISLEGLVLTHQQFSSYEPELFPGLIYRMVK
PRIVLLIFVSGKVVLTGAKKRSDIYEAFENIYPILKGFKKA
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaggagacatacctggagctctacttggaccagtgctcctcccaggatgcccttacg
ccatccagatcacccctgctgagcccagctgtgccttatgatgtggacatgcttacgtca
tccaatccagagactgcatttaatccccagcttgaagaagtcacagaagcatctggcagt
ttctcagctgtggatcttagcttcttaccagatgagctctcccaagaaaataaagaccag
actgtcattaggagcaagcatgaagttgaagaaaactgtaaaactcaaagtcggcaaatt
aggttgcccttacccagccaactggacgctggcctggccttaaacagcagcagtgggtca
ggttcccattcacatctgcaccctgctgatggtaactcagsccagccctctcctgagaaa
ccacactccatgcctctggcgtccataactcctatgacaccaatggcccctatttcagaa
tgttctggaattgtgcctcaactacagaacatagtttccactgtaaacctggcctgtaaa
ttggatctgaagaaaatagctttgcatgcaaaaaacgcagaatataacccaaagagattt
gccgctgtcataatgaggatccgagagcccaggactacagccctcatatttagctctggg
aaaatggtctgcacaggagccaaaagcgaagagcagtctcgacttgcagcgaggaagtac
gcccgtgtggtgcagaagctgggctttcctgccagattcctcgattttacaattcagaac
atggttgcaagctgtgatgtgagatttcctatcagtctggaaggtttggtgctaacccat
cagcagttcagtagttatgaacctgaactgtttcctggccttatttatagaatggtgaaa
ccacgaattgtgttgcttatctttgtatctggaaaagttgtgctgacaggtgccaaaaaa
cgttctgacatctatgaagcatttgaaaacatctatcctattctaaagggttttaaaaaa
gcctga

KEGG   Bos indicus (zebu cattle): 109565755
Entry
109565755         CDS       T04792                                 

Gene name
TBP
Definition
(RefSeq) TATA-box-binding protein
  KO
K03120  transcription initiation factor TFIID TATA-box-binding protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03022  Basal transcription factors
biu05016  Huntington disease
biu05017  Spinocerebellar ataxia
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    109565755 (TBP)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109565755 (TBP)
  09164 Neurodegenerative disease
   05016 Huntington disease
    109565755 (TBP)
   05017 Spinocerebellar ataxia
    109565755 (TBP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565755 (TBP)
   05165 Human papillomavirus infection
    109565755 (TBP)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   TATA-binding proteins
    109565755 (TBP)
Transcription machinery [BR:biu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIID
     109565755 (TBP)
  RNA polymerase III system
    TFIIIB
     109565755 (TBP)
  RNA polymerase I system
    SL1/TIF-1B
     109565755 (TBP)
SSDB
Motif
Pfam: TBP
Other DBs
NCBI-GeneID: 109565755
NCBI-ProteinID: XP_019825225
UniProt: A0A6P5CHU0
LinkDB
Position
11
AA seq 303 aa
MDRNDSLSPFDQYLASPQGAMSPGIPVFSPMMHYGTGLTPQPIQSTDSLSTSEEEZQQQT
TVRTGRLSTTSQQATQEALDQTPQLFDSQPLTTEPLLGTTPLYPSPMTPMIPMTPAMPAS
EIAELVPQLHNVVCTVNLGCKLDLKSIALLARNAEYNPKRFAAVIMRIREPRTTALLFSS
GKMVCTGSKSEEQSRLAARKYARIIQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEPLVLS
XQQFASYEPELFPGLXYRMIKPRIVLLIFVSGKVVLTGAKVRSEIYEAFNNIYSILKGFR
KTS
NT seq 912 nt   +upstreamnt  +downstreamnt
atggatcggaatgatagcctctctccgtttgaccagtatctggcctcccctcaaggtgcc
atgagtcctggaatccctgtcttcagtccaatgatgcattatggcacaggactgactccg
cagccaattcagagcaccgacagtctgtctacttcagaggaggagsagcagcagcagacg
acggtgagaacaggtcggctttcgacgacatcccagcaggcaacccaggaggccttggac
cagacaccacagctcttcgactcacagcctcttacgaccgaacccttgctgggtaccact
cccctgtatccatcccccatgacccccatgatccccatgacccctgccatgccagcctca
gagatcgctgagttggtgccacagctgcacaatgttgtatgcacagtgaatcttggttgt
aaacttgacctaaagagcatcgcccttcttgctcgaaatgctgaatataatcccaagagg
tttgctgctgtaatcatgagaataagagagccccgaaccactgcacttttattcagttct
gggaagatggtgtgcacaggaagcaagagtgaagaacagtccaggctagcagcaagaaaa
tatgccagaatcatacagaagttgggttttccagctaagttcttggacttcaagattcag
aacatggtggggagctgtgatgtgaagttccccataaggttagaaccccttgtgcttagc
crccaacagttcgctagttatgagccagagttatttcctggtttartctacagaatgatc
aaaccgagaattgttctccttatctttgtctctggaaaagttgtgttaacaggtgctaaa
gtcagaagtgaaatttatgaagcctttaataacatctactctattctaaagggtttcagg
aagacatcgtaa

DBGET integrated database retrieval system