KEGG   Bos indicus (zebu cattle): 109564093Help
Entry
109564093         CDS       T04792                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04068  FoxO signaling pathway
biu04146  Peroxisome
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109564093 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109564093 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    109564093 (SOD2)
   04213 Longevity regulating pathway - multiple species
    109564093 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    109564093 (SOD2)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109564093 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109564093
NCBI-ProteinID: XP_019823212
LinkDB All DBs
Position
9
AA seq 222 aa AA seqDB search
MLSRAACSTSRRLVPALSVLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVAEEKYREALEKXDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPQGELLEA
IKRDFGSFAKFKEKLTAVSVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTARYTACSK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcgcgggcggcgtgcagcacgagcaggagactggtgccggccctgagcgtgctg
ggctcccggcagaagcacagcctccccgacctgccgtacgactacggcgccctggagccg
cacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctacgtgaac
aacctcaacgtygccgaggagaagtaccgggaggcgctggagaagsgtgatgttacagct
cagatagctctgcagcctgcgttgaagttcaacggtgggggccatatcaatcacagcatc
ttctggacaaatctgagccctaacggtggtggagaaccccaaggggaattgctggaagcc
atcaaacgtgactttggttcctttgccaaatttaaggaaaagttgactgctgtatctgtt
ggtgtccaaggctccggttggggttggctcggcttcaataaggagcagggacgcttacag
attgctgcttgttctaaccaggatcccctgcaaggaacaacaggtcttatccccctgctg
gggattgacgtgtgggagcatgcttattaccttcagtataaaaatgtcaggcccgattay
ctgaaggccatttggaatgtgatcaactgggagaatgtaactgcacgatacacggcttgc
agcaagtaa

DBGET integrated database retrieval system