KEGG   Bos indicus (zebu cattle): 109564198
Entry
109564198         CDS       T04792                                 

Gene name
NFATC4
Definition
(RefSeq) LOW QUALITY PROTEIN: nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04625  C-type lectin receptor signaling pathway
biu04921  Oxytocin signaling pathway
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109564198 (NFATC4)
   04022 cGMP-PKG signaling pathway
    109564198 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109564198 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109564198 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109564198 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    109564198 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109564198 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    109564198 (NFATC4)
   05161 Hepatitis B
    109564198 (NFATC4)
   05163 Human cytomegalovirus infection
    109564198 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109564198 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109564198 (NFATC4)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    109564198 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 109564198
NCBI-ProteinID: XP_019823302
UniProt: A0A6P5CDY8
LinkDB
Position
10
AA seq 621 aa
GPSPGGRGPEDSWLLLSAPGPPQTSPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEG
PEPPPPPPLPLVRDPGSPGPFDYVGAPSAESIPQKTRRTSSEQAVALPRSEEPAPCNGKL
PSGAEEAGAPPGGPRKEAAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQY
EQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADER
NLRPHAFYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDI
ELRKGETDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPS
ACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLAVPEYS
NKRVSRPVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDASLRGFPSASGPPFGSDMD
FSPPRPPYPSYPHEDPAYXTPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPXXXXXXXX
XXXXXXSXPSVHPPPAEGYSEVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEV
SEIIGRDLSGFPAPPGEEPPA
NT seq 1866 nt   +upstreamnt  +downstreamnt
ggtccgagtcctggaggccgggggccagaggatagctggctactcctcagcgctcctggg
ccccctcaaacctccccacgacctgcctctccatgtggcaagaggcgctattccagctcg
ggaaccccatcttcggcctccccagctctgtcccgccgaggcagcctaggggaggagggg
cctgaaccacctccaccaccccccttgcctctggtccgggatcctggctcccctggcccc
tttgactatgtgggagccccatcagccgaaagcataccccagaagacccggaggacttcc
agcgagcaggccgtggctctgcctcggtctgaggagcctgccccatgcaatgggaagctg
ccctcgggagcagaggaggccggggctcctcctgggggtcctcggaaggaggcggctggc
atggactacctggcggtgccttctccactggcgtggtccaaggcccggattgggggacac
agccccatcttcaggacctctgccctacccccactcgactggcctttgcccagccagtat
gagcagctggagctgaggatcgaggtacagcccagagcccaccaccgggcccactatgag
acagagggcagccggggtgctgtcaaagcagcccctggtggtcaccctgtagtgaagctc
ctgggctacagcgagaagcccctgaccctgcagatgttcatcggcacggcggacgagagg
aacctgcggccccacgctttctatcaggtgcaccgcatcaccggcaagatggtggccacg
gccagctacgaagccgtagtcagcggcaccaaggtgctggagatgaccctgctccctgag
aacaacatggcagccaacattgactgtgccggaatcctgaagctgcggaattcagatatt
gaactgcggaagggcgagacggacattgggcgcaagaacacacgcgtgcggctggtgttc
cgagtacacgtgccccaaggcagcgggaaggttgtctcggtgcagacagcatcggtaccc
atcgagtgctcccagcgatcagctcaggagctgccccaggtggaggcctacagccccagt
gcttgctctgtcaggggaggggaggagctcgtgctgactggctccaacttcctgccagac
tccaaggtggtgttcatcgagaggggccctgatggaaagttgcaatgggaggaggaggcc
acggtgaaccggttgcagagcaatgaggtgactctgaccctggccgtccctgagtacagc
aacaagcgcgtgtcccggccggtccaggtctacttttacgtctccaatgggcggaggaag
cgcagtcctacccagagtttcaagttcctgcctgtgatcttcaaggaggagcctctgccg
gatgcatctctccggggcttcccctcagcatcgggccccccctttggctctgacatggac
ttctcaccacccaggcccccctacccctcctatccccatgaagaccctgcttatngaact
ccttacctgtcagaaggcttcagctatggcacgccccctctgtacccccagacggggccc
ccaccatcctacagacccggcctgcggatgttccctnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnntccnngcccagtgttcaccccccacctgctgagggatacagt
gaggtagggccaagctacggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctccc
gcctga

KEGG   Bos indicus (zebu cattle): 109567554
Entry
109567554         CDS       T04792                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04022  cGMP-PKG signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04921  Oxytocin signaling pathway
biu05135  Yersinia infection
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    109567554 (NFATC2)
   04370 VEGF signaling pathway
    109567554 (NFATC2)
   04022 cGMP-PKG signaling pathway
    109567554 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109567554 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109567554 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    109567554 (NFATC2)
   04660 T cell receptor signaling pathway
    109567554 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    109567554 (NFATC2)
   04659 Th17 cell differentiation
    109567554 (NFATC2)
   04662 B cell receptor signaling pathway
    109567554 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109567554 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    109567554 (NFATC2)
   04380 Osteoclast differentiation
    109567554 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109567554 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109567554 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567554 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    109567554 (NFATC2)
   05161 Hepatitis B
    109567554 (NFATC2)
   05163 Human cytomegalovirus infection
    109567554 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109567554 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109567554 (NFATC2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    109567554 (NFATC2)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 109567554
NCBI-ProteinID: XP_019828145
UniProt: A0A6P5CTI0
LinkDB
Position
13
AA seq 700 aa
MSPRTGLAEDSCLGRHSPVPRPASRSSSPGTKRRHSCAGASVAPLPAASPQRSRSPSPQP
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXL
YPAVEFLGPCEQEERRNSAPESILLVPPTWPKQLVPAIPICSIPVTASLPPLEWPLSHQS
GAYELRIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADE
RILKPHAFYQVHRITGKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNAD
IELRKGETDIGRKNTRVRLVFRVHIPEASGRIVSLQTASNPIECSQRSAHELPMVERQDI
DSCLVYGGQQMILTGQNFTAESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEY
RNKHIRTSVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPALICSPAHGGLGSQ
PYYAQHPMVAEPPSCLVATMAPCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPGLLGY
QQPALMASPLALADAHRSVLVHAGSQGQGAALLHSGPANQQASPVIHYSPTNQPLRCGSH
QEFQHIVYCENFAPGPARPGPPPVSQGQRLSPGSYPTVIQQQNAPSQRAAKNGPPVSDQK
EVLPAGVTIKQEQNLDQTYLDDVNEIIRKEFSGPPVRNQT
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgtcacctcgaaccggcctcgctgaggacagctgcctgggccgccactcgcccgtgccc
cgtccggcctcccgctcctcgtcgcctggtaccaagcggcggcattcgtgcgccggggcc
tcggttgccccgctgcccgcagcctcaccccagcgctcgcggagcccctcgccgcagccn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncctc
tacccggccgtggagttcctgggcccctgygagcaggaggagaggcggaactcggccccc
gaatccatcttgctggtgccrcccacctggcccaagcagctggtgccggccattcctatc
tgcagcatcccagtgaccgcctccctccctccgctcgagtggccgctctcccaccagtcc
ggcgcctacgagctgcggatcgaggtgcagcccaagccacaccaccgagcgcactacgag
acggagggcagccgcggggctgtcaaggccccgacgggcggccaccctgtcgttcagctc
cacggctacatggaaaacaagcccctggggcttcagatcttcattgggacggccgacgag
cggatccttaagccccatgcgttctaccaggtacatcgaattacagggaaaaccgtcacc
accaccagctacgagaagatcgtgggcaacaccaaagtcttggagattccgctggagccg
aaaaacaacatgagggcaaccatcgactgcgccgggatcctgaagctgaggaacgcggac
attgagctgcggaaaggcgagacggacatcgggcggaagaacacgcgcgtgaggctggtg
ttccgagtgcacatccccgaggccagcggaaggatcgtctccttgcagacggcgtccaac
cccatcgagtgctcccagcggtccgcccacgagctgcccatggtggaaaggcaagacatc
gacagctgcctggtgtacggcggccagcagatgattctcacgggacagaacttcacggcc
gagtccaaagtcgtgtttaccgagaagaccacagatgggcagcaaatttgggagatggag
gccacggtggataaagacaagagccagcctaacatgctttttgttgagattccggagtat
cggaacaagcacattcggacttcggtgaaggtgaacttttacgtcatcaacgggaaaaga
aaacgaagccagcctcagcactttacctaccatccagtcccagccatcaagacggagccc
actgatgagtacgaccccgccttgatctgcagccccgcccacgggggcctggggagccag
ccgtactacgcgcagcacccgatggtggcggagcccccctcctgcctcgtggccaccatg
gctccctgccagcagttccgctcggggctctcatcccccgacgcgcgctaccagcagcag
aacccggcggccgtcctctaccagcggagcaagagcctgagccccgggctgctgggctac
cagcagcccgccctcatggccagcccgctggcgctggcggacgcccaccgctccgtgctg
gtgcacgccggctcgcagggccagggcgcggcgctgctgcactccggcccggccaaccag
caggcctcgcccgtcatccactactcgcccaccaaccagccgctgcgctgcgggagccac
caggagttccagcacatcgtgtactgcgagaacttcgcgcctggccccgccaggcccggc
ccgccccctgtcagtcagggtcagaggctgagccctggctcctaccccaccgtcatccag
cagcagaacgcccccagccaaagagccgccaaaaacggacccccggtcagtgaccaaaag
gaagtgttacccgcgggcgtgacgatcaaacaggagcagaacttggaccagacctacttg
gatgacgtcaatgagatcatcaggaaggagttttcaggacctcccgtccgaaatcaaacg
tag

KEGG   Bos indicus (zebu cattle): 109572084
Entry
109572084         CDS       T04792                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04360  Axon guidance
biu04625  C-type lectin receptor signaling pathway
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04921  Oxytocin signaling pathway
biu05135  Yersinia infection
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572084 (NFATC3)
   04310 Wnt signaling pathway
    109572084 (NFATC3)
   04022 cGMP-PKG signaling pathway
    109572084 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109572084 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109572084 (NFATC3)
   04660 T cell receptor signaling pathway
    109572084 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    109572084 (NFATC3)
   04659 Th17 cell differentiation
    109572084 (NFATC3)
   04662 B cell receptor signaling pathway
    109572084 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109572084 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    109572084 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109572084 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109572084 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572084 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    109572084 (NFATC3)
   05161 Hepatitis B
    109572084 (NFATC3)
   05163 Human cytomegalovirus infection
    109572084 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109572084 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109572084 (NFATC3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    109572084 (NFATC3)
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 109572084
NCBI-ProteinID: XP_019834180
UniProt: A0A6P5D8X4
LinkDB
Position
18
AA seq 1061 aa
MSLTCLHEFSGLEKTGTIVSVRYLEPDDCASIYIFNVDPPPSTLNSPLCLPHHGLPSHSS
VLSPSFQLQGHKNYEGTCEIPESKYSPLSGPKPFECPSIQITSISPNCHQEIDAHEDDLH
INDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDV
DSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQSPCHSPRSSITDE
NWLSPRPASGPSSRPTSPCGKRRHSSAEVCYPGSLSPHHSPVPSPGHSPRGSVTEDTWLN
ASVQGGSGLGPAIFPFQYCAETDIPLKTRKTSEDQALILPGKLELCSDDQGNLSPSRETS
IDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPLDWPLPTHFGQCE
LKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYSEKPINLQMFIGTADDRYLRP
HAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRK
GETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELPHIEKYSINSCSV
NGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIKEKCQGAHIVLEVPPYHNPAV
TAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPHPAQTQRTSSDTG
HLHDSVLSAQRSLVCPIQQTYASMVTASHLPQLQCRDESAGKEQHMISSSVVHQPFQVTP
TPPMGSSYQPMQTNVVFNGPTCLPINAASSQEFDPVLFQQDATLPNLINLGCQTPSSIPF
HSSNSGSTGHLLAHTPHSVQTLPHLQTMGYHCSNTGQRSVSSPVADQVTGQPSSQLQPIM
YGPSHSGTATTASPAASHPLASSPLSGPPSPQLQPMPYHSPSSGTASSPSLATRMHPGQH
SAQAQSTGQGGISAPSSLLCHSLCDPASFPPDEATVNIKPEPEEQEPNFSTIGLQDITLD
DVNEVIGRDMSQISVSQGTGASRQAPLPGPSSLDLGRSDGL
NT seq 3186 nt   +upstreamnt  +downstreamnt
atgagtctcacctgtttgcatgaattcagtggacttgagaagacaggaacaattgtatct
gtaagatatcttgagccagatgattgtgcatccatttacatctttaatgtagatccacct
ccatctactttaaactcaccactttgcttaccacatcatggattaccgtctcactcttct
gttttgtcaccatcgtttcagctccaaggtcacaaaaactatgaaggaacttgtgaaatt
cctgaatctaaatacagcccattaagtggtcccaaaccctttgagtgcccaagtattcaa
attacatccatctctcctaactgtcatcaagaaattgatgctcatgaagatgacctacac
ataaatgacccagaaagggaatatttggaaaggccttctagagatcatctctatcttcct
cttgagccatcctaccgggaatcttcccttagtcctagtcctgccagtagcatctcttct
aggagctggttctcagatgcgtcttcttgtgaatctctttcacatatttatgatgatgtg
gattcggagttgaatgaagctgctgcccgatttactctcggatcccctctgacttctcct
ggtggctctccaggaggctgccctggagaagagtcctggcatcaacagtatggacttgga
cattccttgtcacctaggcaatctccttgccactctcctagatctagtatcactgatgag
aattggctgagccccaggccagcctcaggaccctcatcaaggcctacttccccttgtggg
aaacggcggcactctagtgctgaggtttgttaccctgggtccctttcaccgcatcattcg
cctgttccttctcctggtcactcccccaggggaagtgtaacagaagatacctggctcaat
gcttctgtccagggtggatcaggccttggccctgcgatttttccatttcagtactgtgca
gaaactgatattcctctgaaaacaaggaagacttctgaagatcaagctctcatactacca
ggaaaattagaactctgttcagatgaccaagggaatctttcaccatcacgggaaacttca
atagatgatggccttggatctcagtatcctttaaagaaagattcatctggtgaccaattt
ctttcagttccttcaccctttacctggagcaaaccaaagcctggtcacacccctatattt
cgcacatcttcattacctccactagactggcctttaccaactcattttggacaatgtgaa
ctgaaaatagaagtgcaacctaaaactcatcaccgagcccattatgaaactgaaggtagc
cgaggagcagtaaaagcatctactgggggacatcctgtggtgaagctcctgggctacagt
gaaaagccaataaatctacagatgtttattggaacagcagatgaccgatatttacggcct
catgcattttaccaggtgcatcgaatcactgggaagacagttgctactgcaagccaagag
ataataattgccagcacaaaggttctggaaattccacttcttcctgaaaataatatgtca
gccagtattgactgtgccggtattttgaaactccgaaattcagatatagaacttcgaaaa
ggagaaactgatattggcagaaagaatactagagttcgacttgtgtttcgtgtacacatc
ccacagcccaatggaaaagtcctttctctgcaaacagcttctatacctgttgaatgctct
cagcggtctgcccaagaacttcctcatattgagaagtacagtatcaacagttgttctgta
aatggaggtcatgaaatgattgttactggatctaattttcttccagaatccaaaatcatc
tttcttgaaaaaggacaagatggacgacctcagtgggaagtagaagggaaaataatcaag
gaaaaatgtcaaggggctcacattgtccttgaagttcctccatatcataacccagcagtt
acagctgcagtgcaggtgcacttttatctttgcaatggcaagaggaaaaaaagccagtct
caacgttttacttacacaccagttttgatgaagcaagaacacagagaagagattgactta
tcttcagttccatcgttgcctcatcctgcccagactcagaggacttcttcagatacagga
cacctacatgacagcgtactttctgcacagagaagcttggtttgtcccatccagcaaaca
tatgcatccatggtaactgcatcccatctgccacagctgcagtgtagggatgaaagtgct
ggtaaagaacagcatatgatatcttcttcagtcgtgcatcagccttttcaagtcacacca
acacctcctatggggtcttcctatcagcctatgcaaactaatgttgtattcaatggacca
acgtgtcttcctattaatgctgcctctagtcaagaatttgatccagttttgtttcagcag
gatgcaactcttcctaatttaataaatcttggctgtcaaacaccatcatccatacctttt
cattcttcaaattcaggctcaacaggacatctcttagcccacacacctcattctgtgcag
accctgcctcatctgcagacaatgggataccattgttcaaacacaggacaaagatctgtt
tcttctccagtggccgatcaggtcacaggtcagccttcctctcagttacaacccattatg
tatggtccttcacattcagggactgctacaaccgcttccccagcagcctctcatcccctg
gccagttcgccactttctgggccaccatctcctcagctgcagcctatgccttaccattct
cctagctcaggaactgcctcatcaccgtctctagccaccagaatgcatcctggacagcac
tcagctcaagcacaaagtacaggccagggaggtatttctgcaccttcatctttattatgt
cacagtttgtgtgatccagcttcatttccacctgatgaggcaactgtgaacattaaacct
gaacctgaagagcaggaacctaatttttctacaattggtctgcaggacatcactttagat
gatgtgaacgaggtaattgggagagacatgtctcagatttccgtttcccaagggacaggg
gcgagcaggcaggctcccctcccgggtcccagttccctggatttaggaagatccgacggg
ctctga

KEGG   Bos indicus (zebu cattle): 109577750
Entry
109577750         CDS       T04792                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04380  Osteoclast differentiation
biu04625  C-type lectin receptor signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu04662  B cell receptor signaling pathway
biu04921  Oxytocin signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05135  Yersinia infection
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109577750 (NFATC1)
   04310 Wnt signaling pathway
    109577750 (NFATC1)
   04024 cAMP signaling pathway
    109577750 (NFATC1)
   04022 cGMP-PKG signaling pathway
    109577750 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109577750 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109577750 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    109577750 (NFATC1)
   04660 T cell receptor signaling pathway
    109577750 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    109577750 (NFATC1)
   04659 Th17 cell differentiation
    109577750 (NFATC1)
   04662 B cell receptor signaling pathway
    109577750 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    109577750 (NFATC1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109577750 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109577750 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    109577750 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109577750 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109577750 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577750 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    109577750 (NFATC1)
   05161 Hepatitis B
    109577750 (NFATC1)
   05163 Human cytomegalovirus infection
    109577750 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577750 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109577750 (NFATC1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    109577750 (NFATC1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 109577750
NCBI-ProteinID: XP_019842084
UniProt: A0A6P5DVX8
LinkDB
Position
24
AA seq 914 aa
MTGLEEDQEFDFDFLFEFNQSDEGAVAAPAEHYGYAAPGLGAGLPLSAAHPSLPAPCHDL
QSSAAGVSAVGYGGAVDSGPSGYFLSSGGIRPNGAPALESPRIEITSYLGLHHNSSQFLH
EVDVEDVLPKRSPSTATLNLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESSFSYPYAS
PQTSPWQSPCVSPKTTDPEEGFARGLGACGLLGSPRHSPSTSPRTSVTEESWLGARTSRP
SSPCNKRKYGLNGRQLSCSPHPSPTPSPQGSPRVSVTDDTWLGNTTQYTSSAIVAAINAL
STDSSLDLGDGVPVKARKTTLDHSPAVALKVEPAGEDLGTTPPTPDFQPEEFAAFQHIRK
GAFCDQYLSVPQHPYPWARPRSPASYTSPSLPALDWQLPSHSGPYELRIEVQPKSHHRAH
YETEGSRGAVKASAGGHPSVQLHGYVESEPLTLQLFIGTADDRLLRPHAFYQVHRITGKT
VSTASHEAVVCSTKVLEIPLLPENNMRATIDCAGILKLRNSDIELRKGETDIGRKNTRVR
LVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASGPVLGGKRMVLSGHNF
LQDSKVIFVEKAPDGHHIWEMEAKTEGDLCKPNSLVVEIPPFRNQRITSPVQVNFYVCNG
KRKRSQYQHFTYLPANVPIIKTEPSDDYEPALTCGPMSQGLSPLPKPCYGQPLALPPDPG
ACLMPGFPPRPQGSASPELHDLSCAPYGSATAGPGHSPLGLPRPVGGVLASQEAXRPSGV
PPGPPQPPPPTLLQPQVSPTSSGSCSXGRRPALCPHSPSSPLPPGTRELTRLQPCGPAHP
CGTGHQQHQPPEVPSSEPAAARPPPPPEVREDSNRSLAPIPVTVKREPQELDPLDLDDVN
EIIRNDLSSTNIHS
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgactttgacttcctcttcgagtttaaccag
agcgacgagggcgccgtcgcggcccccgcagagcactacggctacgccgcccccggcctg
ggtgcgggcctgcccctctctgcggctcacccctcgctgccygctccatgccacgacctg
cagagctcggccgcgggcgtctccgccgtgggctatggcggggcagtggacagcgggccc
tcaggctacttcctgtcatccggcggcatccggcccaacggggcaccggccctggagagc
ccgcgcatcgagatcacctcctaccttgggctgcaccacaacagcagccagttcctgcat
gaggtggacgtggaggacgtcctccccaagcggtccccatccacggccacgctgaacctg
cccagcctggaggcctaccgtgacccctcctgcctgagccccgccagcagcctgtcctcc
cgaagctgcaactctgaggcctcgtcctacgagtccagcttctcgtacccatacgcgtct
ccgcagacgtccccctggcagtccccctgcgtgtcccccaagaccacagaccccgaggag
ggcttcgcccgtggcctgggggcctgcggcctgctcgggtccccacggcactcgccctcc
acctccccccgcaccagcgtcaccgaggagagctggctgggggcccgcacgtccaggccc
tcgtccccctgcaacaagcgcaagtacgggctcaacggccggcagctgtcctgctccccg
cacccctcgcccacgccgtccccgcagggctcgccgcgggtcagcgtcaccgacgacacc
tggctgggcaacaccacacagtacaccagctcggccatcgtggccgccatcaacgccctg
agcaccgacagcagcctggacctgggtgacggcgtcccggtcaaggcccgcaagaccacg
ctggaccactcgcccgcggtggcgctcaaggtggagccggcgggcgaggacctggggacc
acgccgcccacgcctgacttccagcccgaggagttcgcggccttccagcacatccgcaag
ggcgctttctgcgaccagtacctgtcggtgccgcagcacccgtacccgtgggcccggccg
cggtcccccgcgtcctacaccagcccgtccctgccggctcttgactggcagctgccgtca
cactcaggaccctacgagctgaggatcgaggtgcagcccaagtcccaccaccgtgcccac
tacgagacggagggcagccgcggggccgtgaaggcatcagccgggggccaccccagcgtg
cagctgcatggctatgtggagagcgagcctctgaccctgcagctcttcatcggcacggcg
gacgaccggctgctgaggccacacgccttctatcaggtgcaccggatcacgggcaagacc
gtgtccaccgccagccacgaggccgtcgtctgcagcaccaaggtcctggagatcccgctg
ctgccggagaacaacatgcgcgccaccatcgactgtgccgggatcctgaagctcaggaac
tccgacatcgagctgcgcaagggggagacggacatcgggagaaagaacacgcgggtgcgg
ctggtcttccgcgtccacatcccgcagcccaacggccggacgctgtcactgcaggtggcc
tccaaccccatcgaatgctcccagcgctcggcccaggagctgcccctggtggagaagcag
agtgcggccagcggccccgtcctcggagggaagaggatggtcctctccggccacaacttt
ctgcaggactccaaggtcatttttgtggagaaagcaccagatgggcaccacatctgggag
atggaggcaaaaactgaaggagacctgtgtaagccgaactcgctggtggtggagatcccg
cctttccgcaaccagaggataaccagccctgtgcaggtcaacttctacgtctgcaacggg
aagaggaagcggagccagtaccagcacttcacctacctgcctgccaacgttccaatcata
aaaacggagcccagcgatgattacgagcctgccctcacctgtggaccaatgagccagggc
ctgagcccgctccccaagccttgctacggccagccgctcgccctgccgcccgacccggga
gcctgcctcatgcctggcttcccaccccgtccacagggcagtgccagccctgagctccac
gacctttcctgcgccccttacggctcggccacggccggcccgggccacagccccctcgga
cttccgcggccagtcggtggggtcctcgccagccaggaggcgcsgagaccctcgggtgtg
cctcccgggcccccccagccaccgccccccactctgctgcagccacaggtgagtccgacg
tcaagcggtagctgctccycggggcgccggccagcgctctgtccccacagcccctcctct
ccgctgccgcctgggacccgagagctgacccgcctgcagccctgtggcccagcgcacccc
tgcgggacgggccaccagcagcaccagccacctgaggttccgagcagcgagcccgccgcc
gcccggcccccgccgccgcccgaggtgcgtgaggacagtaatcgtagtctggcccccatt
cccgtaacggtcaagcgagagcctcaggagctggacccgctcgacctggatgacgtaaat
gagataatccggaatgacctctccagcaccaacatccactcgtag

DBGET integrated database retrieval system