KEGG   Bos indicus (zebu cattle): 109564464
Entry
109564464         CDS       T04792                                 

Gene name
IL25
Definition
(RefSeq) interleukin-25
  KO
K05493  interleukin 17E
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109564464 (IL25)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    109564464 (IL25)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109564464 (IL25)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109564464 (IL25)
SSDB
Motif
Pfam: IL17 Arteri_Gl
Other DBs
NCBI-GeneID: 109564464
NCBI-ProteinID: XP_019823467
UniProt: A0A6P5CEJ3
LinkDB
Position
10
AA seq 169 aa
MYQAMAFLAMVMGTHTLCLGSQRCCTHWPSCCPSKGQNSTEEWLKWNSVLMPPPETTSLA
HHPEPCSSSRDGPLNSRSIAPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPLG
NSELLYHNQTVFYRRPCPGQQGDHHGYCLERRLYRVSLACVCVRPRVMA
NT seq 510 nt   +upstreamnt  +downstreamnt
atgtaccaggcaatggcattcttggcaatggtcatgggaacccacaccctctgtttgggg
tcccagaggtgttgcacccactggcccagctgctgccccagcaaaggacagaattccact
gaggagtggctgaagtggaacagtgtgctcatgcctcccccagagaccaccagcctcgcc
caccacccagaaccctgcagttccagcagggatggacccctcaacagccgctccatcgcc
ccctggagatatgagttggacagagacttgaaccggctcccgcaggatctgtaccacgca
cgttgcctgtgtccacactgtgtcagcctgcagacgggctcccacatggaccccctggga
aactcagagctgctctaccacaaccagaccgtcttctaccggcggccgtgccctggacag
cagggcgaccaccatggctactgcctggaacgcaggctctaccgtgtctccttggcttgc
gtgtgcgtgcggccccgtgtgatggcctag

DBGET integrated database retrieval system