KEGG   Bos indicus (zebu cattle): 109564642
Entry
109564642         CDS       T04792                                 

Gene name
POLK
Definition
(RefSeq) DNA polymerase kappa isoform X1
  KO
K03511  DNA polymerase kappa [EC:2.7.7.7]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03460  Fanconi anemia pathway
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    109564642 (POLK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109564642 (POLK)
   05202 Transcriptional misregulation in cancer
    109564642 (POLK)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109564642 (POLK)
   05212 Pancreatic cancer
    109564642 (POLK)
   05225 Hepatocellular carcinoma
    109564642 (POLK)
   05226 Gastric cancer
    109564642 (POLK)
   05214 Glioma
    109564642 (POLK)
   05216 Thyroid cancer
    109564642 (POLK)
   05220 Chronic myeloid leukemia
    109564642 (POLK)
   05217 Basal cell carcinoma
    109564642 (POLK)
   05218 Melanoma
    109564642 (POLK)
   05213 Endometrial cancer
    109564642 (POLK)
   05224 Breast cancer
    109564642 (POLK)
   05222 Small cell lung cancer
    109564642 (POLK)
   05223 Non-small cell lung cancer
    109564642 (POLK)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109564642 (POLK)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109564642 (POLK)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     109564642 (POLK)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Y-family DNA polymerases
    109564642 (POLK)
SSDB
Motif
Pfam: IMS IMS_C IMS_HHH ATP-cone
Other DBs
NCBI-GeneID: 109564642
NCBI-ProteinID: XP_019823621
UniProt: A0A6P5CCS8
LinkDB
Position
10
AA seq 911 aa
MGTPLCCILGRTLLRAPRSLLGVVVAVRRQLVYTMGSTKEKSDGTKEKNDNYKDDLLLRM
GLNDNKAGMEGLDKEKINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAKITSEQL
RKAQLQVDRFAVELEQSRDLNSTIVHIDMDAFYAAVEMRDNPELKDKPIAVGSMSMLSTS
NYHARRFGVRAAMPGFIAKRLCPQLIIVPPNFDKYQAVSREVKEILTDYDPNFMAMSLDE
AYLNITKHLEERKNWPEDKRKYFITAGNSLENDKPGKEVNELSEHEGSISPLLFEDSPPD
LQSPGNPSQVNFEEPNNPQIHQNSIVFGTSAEEVVKEIRFRIEQKTTLTASAGIAPNTML
AKVCSDKNKPNGQYQILPNRQAVMDFIKDLPIRKVSGIGKVTEKMLKALGIITCTELYQQ
RALLSLLFSETSWHHFLHISLGLGSTHLARDGERKSMSVERTFSEISKAEEQYSLCQELC
SELAQDLQKKGLKGRTVTIKLKNVNFEVKTRASTVSTVVSTAEEIFVIAKELLRTEIDAD
FPQPLRLRLMGVRLSGFPNEEEKKHQQRSIIGFLQPGNQALSATGCILEKTDKDQFLKPA
QMSHKKSFFDKKRSERKASPQDTFTCETVNKQSLQTSQSFQVLNKKMSENLETEEKSHSC
QTFTCPVCFREQGSVSLEAFNKHVDACLDGPSISGNSKMSSCSHASSTEVNEKENVCDSV
SLCEKQGYETHQKNTEITSVDPIELVETTGKPSNTEDTSALSNKPSEEEECSGLSSKLFN
MDPQNSCTVSLENEDVGSLRRQESPQPNLYEVISDQVLVCPVCNLEQKTSDLTLFNVHVD
VCLNKGIIQELRKDKINPCNQPKESAKSTDNSGKAQKTGNKTKRPGLMTKYSASKKXKPN
NPRHTLDVFFK
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggggaccccgctgtgctgcattctgggaaggacgctgctccgtgcgccgcgcagcctc
ctgggagttgtagtcgcggtccggaggcaactggtttacaccatgggtagcacaaaggag
aagagtgatggcacaaaggagaagaatgacaattacaaagacgatcttctgcttaggatg
ggacttaatgataataaagctggaatggaaggattagacaaagagaaaatcaacaaaatt
ataatggaagccacaaagggatccagattttatggaaatgagctcaagaaagaaaagcaa
gtcaaccaacgaattgaaaatatgatgcaacaaaaagctaaaattaccagcgagcagcta
aggaaagcacaattacaggttgacagatttgcagtggaattggagcagagccgggatctg
aacagcaccatagtgcacattgacatggacgctttctaygcagctgtagaaatgagggac
aatccagagctgaaggataaacccattgctgtaggatcaatgagtatgctgtctacttca
aattaccacgcaaggagattcggtgttcgtgcagccatgccaggatttattgctaaaaga
ctctgcccacagcttattatagtgcccccaaactttgacaaataccaagctgtgagtaga
gaggttaaggaaatccttactgattatgaccccaattttatggccatgagtcttgatgaa
gcctacctgaatataacaaagcatttagaggaaagaaaaaattggcctgaggacaaaagg
aagtatttcatcacagcagggaactctctagaaaacgataaaccaggaaaggaagttaat
gaactgagtgagcatgaaggatccatctctccactcctttttgaagatagtcctcctgat
ttgcagtccccaggaaatccttcccaagtgaactttgaagagccaaataatcctcaaata
caccaaaactcaattgtttttggaacatcagcggaggaagtggtaaaggaaattcgtttc
agaatcgagcagaaaacaacactcacagccagtgcaggcattgcacccaatacgatgtta
gcaaaagtatgcagtgataagaataaaccaaacggacaataccaaattctacctaacagg
caagctgtaatggacttcattaaggacttacccattagaaaggtttctggaataggaaaa
gttacagagaaaatgttaaaggcccttggaattattacttgtacagaactgtaccaacag
agggcattactttctctccttttctctgaaacatcttggcatcattttcttcatatttcc
ctgggtctaggttcaacacacctggcaagggatggagagaggaaaagcatgagtgttgag
aggacattcagtgagataagtaaagcagaagaacagtacagcttgtgccaagaactttgc
agtgaacttgctcaagatctacagaaaaaaggacttaagggtagaactgttaccattaag
ctaaagaaygtgaattttgaagtaaaaactcgtgcctctacagtttcaactgttgtttca
actgcagaagaaatatttgttatagctaaagaactgctaagaacagaaattgatgctgat
tttccacaacccttgagattaagacttatgggggtgcggctctctggttttcccaatgaa
gaggagaagaaacaccaacaaaggagcattattggcttcttacagcctggaaaccaagcc
ctttcagccaccgggtgtatattagagaaaactgacaaagatcagtttctaaaacctgca
caaatgtctcataagaagagtttctttgataaaaaacgatctgaaaggaaagcgagyccc
caagacacatttacatgtgaaaccgtaaataaacaaagtttgcaaacatcacagtcattc
caggttttaaacaagaagatgagtgagaatttagaaacagaggagaaatcacatagctgt
cagacatttacctgtcctgtctgctttagggagcaaggaagcgtcagtctggaagccttt
aataaacatgtagatgcatgtcttgatggaccttccatcagtggaaactccaaaatgtcc
tcgtgttcacacgcttcctctacagaagtaaacgagaaagaaaatgtatgtgattctgtc
tctctctgtgagaagcagggttatgaaacccaccagaagaatacagagatcacgtcagta
gatcctatagagctggtagagactaccggtaaaccatcaaatacagaagatacaagtgct
ttaagtaataagcccagtgaagaagaggaatgttctggtctttcaagcaaattatttaat
atggatcctcagaattcttgtactgtttcattggaaaatgaagatgttgggtcattaaga
aggcaagaatccccccaacctaatttatatgaagtaatcagtgaccaagttctagtttgt
cctgtttgtaacctagaacaaaagacttcagatcttaccctattcaatgtgcatgtagat
gtttgcttaaataaaggcattatccaggaactgagaaaggataagattaatccatgtaac
caacccaaagaaagcgccaaaagtactgataactcaggcaaagcgcagaagactggaaac
aaaacaaaaaggccaggattgatgacaaagtactcagcatcaaagaaamcaaaaccaaac
aatcccagacacactcttgatgtattttttaaatga

DBGET integrated database retrieval system