KEGG   Bos indicus (zebu cattle): 109564781
Entry
109564781         CDS       T04792                                 

Gene name
IRF9
Definition
(RefSeq) interferon regulatory factor 9 isoform X1
  KO
K04693  interferon regulatory factor 9
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04621  NOD-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu05160  Hepatitis C
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109564781 (IRF9)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109564781 (IRF9)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109564781 (IRF9)
   04625 C-type lectin receptor signaling pathway
    109564781 (IRF9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109564781 (IRF9)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109564781 (IRF9)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109564781 (IRF9)
   05171 Coronavirus disease - COVID-19
    109564781 (IRF9)
   05164 Influenza A
    109564781 (IRF9)
   05162 Measles
    109564781 (IRF9)
   05168 Herpes simplex virus 1 infection
    109564781 (IRF9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109564781 (IRF9)
   05169 Epstein-Barr virus infection
    109564781 (IRF9)
   05165 Human papillomavirus infection
    109564781 (IRF9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109564781 (IRF9)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    109564781 (IRF9)
SSDB
Motif
Pfam: IRF-3 IRF Herpes_capsid
Other DBs
NCBI-GeneID: 109564781
NCBI-ProteinID: XP_019823847
UniProt: A0A6P5CFQ3
LinkDB
Position
10
AA seq 459 aa
MPRISLQTSQLGMLKRKHFWMASGRTRCTRKLRNWVVEQVESGQFPGVCWEDAAKTMFRI
PWKHAGKQDFREDQDAAFFKAWAIYKGKYREGSSEGPAIWKTRLRCALNKSCEFEEVPEI
GHRDGAEPYKVYRLLPPGTVPAQSGTQKLPSKRPHSSASSEKKEEEVTAKNCILSPSLLQ
EPPQNEMVETNGGAGRLDFGSTGSSSSSSSSSGSSSSSSNSPEPQEGRDTAEALFQGELL
SLEVLPPPDSDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSSSQCSMEQVIFPKPDPRE
PAHRLLNQLQRGVLLASNSRGLFVQRLCPIPISWNAPQMPPGPGPHLLPTNECVELFRTS
YFCRDLARYFQGLGPPPKFQVTLNFWEENPDPSHTSQSLIAVQMEQAFARRMLKETPEEQ
AATLSLLQSLQDPVPPLLSIPPVFFETASASLLSTCLPQ
NT seq 1380 nt   +upstreamnt  +downstreamnt
atgcctaggatttccctccagacgtcacagcttgggatgttaaaaagaaagcatttttgg
atggcatcaggcaggacgcgctgcacccgaaagctccggaactgggtggtggagcaagtg
gagagcgggcagttcccaggagtgtgctgggaggatgcggccaagaccatgttccggatc
ccctggaagcacgcaggcaagcaggacttccgggaggaccaggatgccgccttcttcaag
gcctgggcgatatacaaggggaagtacagggaggggagctcggaaggccctgccatctgg
aagactcgtttgcgctgtgctctcaacaaaagttgtgaatttgaggaggttcctgagatc
ggccacagggatggcgctgagccctacaaggtgtaccgactgctgccaccaggaactgtc
cccgctcaatcagggacccagaaattaccatcaaagcgaccccacagttctgcatcctct
gagaagaaagaggaagaagttaccgcaaagaactgcatactcagcccctcgttgctccag
gagccccctcagaatgagatggtggagaccaatgggggagctggccgtttagactttggg
agcaccggaagcagcagtagcagcagcagcagcagcggaagcagcagcagcagcagcaac
agccctgagcctcaggaaggtagggacacagctgaggctcttttccagggagaactgctg
tccctggaggttctgccccctccagattcagactactctctgctgctcaccttcatctac
aacgggcgtgtggtgggtgaggcccaggtgcagagcctggactgccgcctcgtggctgag
ccctcaagctcccagtgcagcatggagcaggtgatctttcccaaacccgacccacgcgag
cccgcccaccgtctgctgaaccarctccagagaggggtcctgctggccagcaactcccgg
ggcctctttgtgcagcgcctctgccccattcccatctcctggaacgcgccccagatgcca
cctggcccgggtccgcacctgctgcccaccaacgagtgcgtggagctcttcagaaccagc
tacttctgcagagacttggccaggtacttccagggcctggggcccccacccaagtttcaa
gtgacactgaacttctgggaggagaaccctgaccccagccacacctcacagagtctgatt
gcggtgcagatggagcaggcctttgcccgacgtatgctgaaggagaccccagaggagcag
gcggccaccctgtctctgctgcagagcctgcaggacccggtgcctcctctcctctctatc
ccgcccgtcttctttgagacagcctcagcctccttgctgtcaacctgcctcccacagtga

DBGET integrated database retrieval system