KEGG   Bos indicus (zebu cattle): 109564986Help
Entry
109564986         CDS       T04792                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00052  Galactose metabolism
biu00500  Starch and sucrose metabolism
biu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109564986 (GANC)
   00500 Starch and sucrose metabolism
    109564986 (GANC)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109564986 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 Zfx_Zfy_act
Motif
Other DBs
NCBI-GeneID: 109564986
NCBI-ProteinID: XP_019824153
LinkDB All DBs
Position
10
AA seq 914 aa AA seqDB search
MESAEKEEISVEDEAVDKNVFKDCSKIAFYRRQKQLLSKKSTYRALLDSVTPGEDSARFQ
IINEPAKVPLLAEVCGIEGNIFRLKINEEIPLKPRYEVPDVLTSKLTTVRLTSCPGDTGS
LVLASGKGDLKCHITANPFKVDLVSEEEVVMSINSLGQLYFEQLQIPPKQRATKKNEEDA
SIDTTQENQEELGLWEEKFENFVDVKVNGPASIGLDFSLHGFEHLYGIPQHAESHQLKNT
SDSDAYRLYNLDVYGYKIHDKMGIYGSVPYLLAHKLGRTLGIFWLNASETLVEIKTEPAV
KYTLTQTGPVAAKQKVGSRTDVHWMSESGIIDVFLLTGPTPSDVFKQYSYLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDVMWLDIEHTEGKRYFTWDKKRFPNPKR
MQDLLRSKKRKLVVISDPHVKVDPNYSVYAKAKEQGFFVRNHEGGDFEGVCWPGLSSYLD
FTNPKVRKWYSSLFAFSVYQGSTDILHIWNDMNEPSVFKGPEQTMQKNAIHHGNWEHREL
HNIYGFYQQMATTEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSHLKISIP
MLLTLSVTGISFCGADVGGFIGDPEAELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EHTRLIREAIRERYTLLPYWYSLFYSAHVASQPVMRPLWVEFPNELETFSVEDEYMLGGA
LLVHPVTEPKATVVDVFLPGSSEIWYDSKTFAHWKGACTVKIPVTLDAIPVFQRGGSVVP
IKTTIGRSTGFMTNSPYGLRVALSTKGSAMGEFYLDDGHSFQYLHQKQFLHRKFSFSSGV
LTNSCADERGHYPSKCVVEQILVLGLKKQPSSVTAHSADGSAQPVAFTYHATTSTLKLET
LSLNIGADWKVRVQ
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaatcagctgagaaagaggaaatcagtgttgaagatgaagctgtggataaaaacgtt
ttcaaagactgcagcaagattgctttctacaggcgtcagaaacagctgctctccaagaag
tctacctaccgggcattactggactcagtcacaccaggcgaagacagtgccaggttccaa
atcatcaacgaaccagcaaaggttccrctcctggctgaagtttgtggcatagagggaaat
attttcagacttaaaatcaatgaagaaatacccttgaaacccaggtatgaagttcctgat
gtcctcacaagcaagctaaccactgtaaggctgacttcttgcccaggggatacaggcagt
ctggtgttggcaagtggaaaaggagatctgaagtgtcacatcacggcaaacccattcaag
gttgacttggtatctgaagaagaggttgtaatgagcataaactccctgggccaattgtac
tttgagcagctgcagattcctcccaagcaaagagctaccaagaaaaatgaggaggatgca
tcaattgacaccactcaggaaaatcaagaggaactgggcctctgggaggagaaatttgaa
aattttgtggatgtcaaagttaacggtcctgcctccattggtttggatttctctttgcat
ggttttgagcatctctatggaatcccgcaacatgctgaatcacaccaacttaaaaacaca
agtgatagtgatgcttaccgtctttataacctagatgtctatggatataaaatacatgac
aaaatgggcatttatggttcagtgccttatctcctggcccacaaactgggcagaactcta
ggcattttttggctaaatgcctcagaaacactagtggagatcaaaacagaacctgctgta
aagtacacactgacccagacgggcccagttgctgctaaacaaaaggtcgggtctcgaact
gatgtgcactggatgtcagagagtggaatcattgatgtttttctgttgacaggacctact
ccttctgatgtcttcaagcagtattcataccttacaggcacacaagccatgccccctctc
ttttctctggggtaccatcagtgccgctggaactatgaagatgagcaggatgtaaaggca
gtggatgccggatttgatgaacatgacattccttatgatgtcatgtggctggacatagag
cacacagagggcaagaggtacttcacctgggacaagaaaagattcccaaaccccaaaagg
atgcaagatctgctcaggagcaaaaaacgtaagcttgtggtcattagtgacccccacgtc
aaggttgatcccaactactcagtgtatgctaaggccaaagaacagggcttctttgtgagg
aatcatgaaggaggagactttgaaggtgtatgctggcctggtctctcctcttacctggat
ttcaccaaccccaaagtcagaaagtggtattctagtcttttcgctttctctgtttatcag
ggatctactgacatcctccacatatggaacgacatgaatgagccctctgtctttaaaggc
ccagagcaaaccatgcagaagaatgccattcatcacggcaactgggagcaccgggaactt
cacaacatctatggcttttatcagcaaatggccactacagaaggactgatccagcgatct
aaaggaaaggagagaccctttgttcttacacgttcattctttgctggatcacaaaaatat
ggtgctgtgtggacaggtgataacacggcagagtggagtcacctgaaaatttctatccct
atgttacttaccctcagcgtgactgggatctctttttgtggagcggatgtaggtggcttc
atcggggatccagaggcagagctgctagtgcggtggtaccaggcaggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgggagccctggctctttggggag
gagcacacccggctcatccgagaagccatcagagagcgctacaccctcctgccctactgg
tattctctgttctactctgcacacgtggcttctcaacctgtcatgaggcctctgtgggta
gagttccctaatgaattagagacttttagtgtggaagatgaatacatgctgggaggtgct
ttattggttcatccagtcacagaaccaaaagctactgttgttgatgtgtttctgccaggg
tcaagtgagatttggtatgactctaagacatttgctcactggaaaggagcgtgtacagta
aagatcccagtaaccttggacgctataccagtgtttcaacgtggtggaagtgtggtacca
ataaagaccactataggaagatccacaggcttcatgactaattccccatatggactccga
gtcgctctaagcactaagggttctgccatgggtgaattctatctcgatgatgggcattct
ttccaatacctccaccagaagcaattcttgcacaggaagttttcattttcctcaggtgtt
ttgaccaacagttgtgctgacgagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcctaggcctcaagaagcagccatcttctgtgactgcccactcagctgatggc
agcgctcagcctgtggcttttacgtaccatgccacaacatccaccctaaagctggagacg
ctctcgctgaacattggtgcggactggaaggtgcgcgtccagtga

DBGET integrated database retrieval system