KEGG   Bos indicus (zebu cattle): 109565174
Entry
109565174         CDS       T04792                                 

Gene name
BMP4
Definition
(RefSeq) bone morphogenetic protein 4 isoform X1
  KO
K04662  bone morphogenetic protein 4
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04350  TGF-beta signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04919  Thyroid hormone signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109565174 (BMP4)
   04390 Hippo signaling pathway
    109565174 (BMP4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109565174 (BMP4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109565174 (BMP4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109565174 (BMP4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565174 (BMP4)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109565174 (BMP4)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109565174 (BMP4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109565174 (BMP4)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109565174 (BMP4)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109565174 (BMP4)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109565174 (BMP4)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109565174
NCBI-ProteinID: XP_019824484
UniProt: A0A6P5CGM5
LinkDB
Position
10
AA seq 456 aa
MQEGRGGRRGETGAELGPEARSHSVVPSRATHCRSSSEPFQQVCSRLAVKNHGLLLYALF
SVILLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFXAXLLQMFGLRRRPQP
SKSAVIPDYMRDLYRLQSGEEEEEEQIQGIGLEYPERPASRANTVRSFHHEEHLENIPGT
SENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWDQGFHRINIYEVMKPPAEVVP
GHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHV
RISRSLPQGSGDWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHPQRARKKNKNCRRHS
LYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKAC
CVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
NT seq 1371 nt   +upstreamnt  +downstreamnt
atgcaagaaggcagaggaggaaggaggggggaaacgggagcggagctcggcccggaagct
aggagccattccgtagtgccatccagagcaacgcactgccgcagctcctctgagcctttc
cagcaagtttgttcaagattggctgtcaagaatcatggactgttattatatgccttgttt
tctgtcatcctgctaggaggcgcgagccatgctagtttgatacctgagacggggaagaaa
aaagtcgccgagattcagggccacgcgggaggacgccgctcagggcagagccatgagctc
cttcgggacttcgrggccrcacttctgcagatgttcgggctgcgccgccgcccgcagcct
agcaagagcgcagtcatcccggattacatgcgggatctttacagacttcagtctggggag
gaggaagaggaagagcagatccagggcatcggtctggagtatcctgagcgccccgccagt
cgggccaacaccgtgaggagcttccaccacgaagaacatctggagaacatcccagggacc
agcgaaaactctgcttttcgtttcctctttaacctcagcagcatcccagagaacgaggtg
atctcgtctgccgagcttcgactcttccgggagcaggtggaccagggccctgactgggat
cagggctttcatcgtataaacatttatgaggttatgaagcccccggcagaagtggtgcct
gggcacctcatcacacgactactggacacaagactggtccaccacaatgtgacgcggtgg
gaaacttttgatgtgagccctgcagtccttcgctggacccgggagaagcagcccaactat
gggctggccattgaggtgacccacctccatcagacacggacccaccagggccagcatgtc
aggattagccgatcgttacctcaagggagtggggattgggcccagctccggcccctcctg
gtcacctttggccatgatggccggggacatgccttgacccgacgcaggagggccaagcgt
agccccaagcatcacccacagagggcccggaagaagaataagaactgccggcgccactcg
ctctacgtggacttcagtgatgtgggctggaatgactggattgtggccccaccaggctac
caggcattctactgccacggggactgcccctttccactggccgaccacctcaactcaacc
aaccacgccattgtgcagaccctggtcaactctgtcaattccagtatccccaaagcctgt
tgtgttcccaccgaactcagcgccatctccatgctgtacctggatgagtatgacaaggtg
gttctgaaaaattatcaggagatggtagtggagggatgtgggtgccgctga

KEGG   Bos indicus (zebu cattle): 109567176
Entry
109567176         CDS       T04792                                 

Gene name
BMP2
Definition
(RefSeq) bone morphogenetic protein 2
  KO
K21283  bone morphogenetic protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04350  TGF-beta signaling pathway
biu04390  Hippo signaling pathway
biu05200  Pathways in cancer
biu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    109567176 (BMP2)
   04390 Hippo signaling pathway
    109567176 (BMP2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567176 (BMP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567176 (BMP2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    109567176 (BMP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109567176 (BMP2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109567176 (BMP2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109567176 (BMP2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Morphogens
   109567176 (BMP2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109567176
NCBI-ProteinID: XP_019827455
UniProt: A0A6P5CP42
LinkDB
Position
13
AA seq 395 aa
MVAGTRCLLALLLPQVLLGGAAGLIPELGRRKFAASAGRSSSQPSDDVLSEFELRLLSMF
GLKQRPTPSRDAVVPPYMLDLYRQHSGQPGAPAXXXRLERAASLANTVRSFXHEESLEEL
PEMSGKTTRRFFFNLTSIPTEEFITSAELQVFRKHMPEALENNSSFHHRINIYEIIKPAT
ANSKFPVTRLLDTRLVTQNASRWESFDVTPAVMRWTAQGLTNHGFVVEVAHPEDSHGASK
RHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHRREKRQAKHKQRKRLKSSCKRHPL
YVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNSVNSKIPKACC
VPTELSAISMLYLDENEKVVLKNYQDMVVEGCGCR
NT seq 1188 nt   +upstreamnt  +downstreamnt
atggtggccgggacccgctgtcttctagcgttgctgcttccccaggtcctcctgggcggc
gcggccggcctcattcccgagctgggccggaggaagttcgctgcgtctgctggccgctcc
tcatcccagccttcggacgacgtcctgagcgagttcgagttgcggctgctcagcatgttc
ggcctgaagcagagacccacccccagcagggacgccgtggtgcccccctacatgctggac
ttgtaccgccagcactcgggccaacccggtgcgcctgccnnnnnnnaccggctggagagg
gcagccagcctcgccaacaccgtgcgcagcttccrtcacgaagaatctttggaagaactg
ccggaaatgagtgggaaaacaacccggcgattcttctttaatttaacttctatccccact
gaggagtttatcacctcagcagaacttcaggtctttcggaaacatatgcccgaagctttg
gaaaacaatagcagtttccatcaccgaattaatatttatgaaattataaaacctgccaca
gctaactccaagttccctgtgacgagacttttggacaccaggttggtgactcagaatgcc
agtaggtgggagagcttcgatgtcacccccgccgtgatgaggtggaccgcccaggggctc
accaaccatgggttcgtggtggaggtagcccacccagaggacagccatggggcctccaag
aggcatgtgcggattagcaggtctttgcaccaagatgagcacagctggtcacagataagg
cccttgcttgtcacttttggccacgatgggaaaggacaccctctccacagaagagaaaag
cggcaagcaaaacacaaacagcggaaacgcctcaagtccagctgtaagagacacccttta
tatgtggacttcagtgatgtggggtggaatgactggatcgttgcaccgccggggtatcat
gccttttactgccatggggagtgcccttttcccctggccgatcaccttaactccacgaat
catgccattgtccaaactctggtcaactcagttaactctaagattcccaaggcatgctgt
gtcccaacagagctcagcgccatctccatgctgtaccttgatgagaatgagaaggtggta
ttaaagaactatcaggacatggttgtcgagggttgtgggtgtcgttag

DBGET integrated database retrieval system