KEGG   Bos indicus (zebu cattle): 109565371
Entry
109565371         CDS       T04792                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04218  Cellular senescence
biu04350  TGF-beta signaling pathway
biu04390  Hippo signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05410  Hypertrophic cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109565371 (TGFB3)
   04350 TGF-beta signaling pathway
    109565371 (TGFB3)
   04390 Hippo signaling pathway
    109565371 (TGFB3)
   04068 FoxO signaling pathway
    109565371 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109565371 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109565371 (TGFB3)
   04218 Cellular senescence
    109565371 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565371 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109565371 (TGFB3)
   05212 Pancreatic cancer
    109565371 (TGFB3)
   05225 Hepatocellular carcinoma
    109565371 (TGFB3)
   05226 Gastric cancer
    109565371 (TGFB3)
   05220 Chronic myeloid leukemia
    109565371 (TGFB3)
   05211 Renal cell carcinoma
    109565371 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109565371 (TGFB3)
   05321 Inflammatory bowel disease
    109565371 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109565371 (TGFB3)
   05414 Dilated cardiomyopathy
    109565371 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109565371 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109565371 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565371 (TGFB3)
   05161 Hepatitis B
    109565371 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109565371 (TGFB3)
   05144 Malaria
    109565371 (TGFB3)
   05145 Toxoplasmosis
    109565371 (TGFB3)
   05140 Leishmaniasis
    109565371 (TGFB3)
   05142 Chagas disease
    109565371 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109565371 (TGFB3)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109565371 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109565371
NCBI-ProteinID: XP_019824848
UniProt: A0A6P5CHQ1
LinkDB
Position
10
AA seq 452 aa
MHLLAKPQSSGSREAAWFSSLLLHDCRGLLLPGLAAFLPGPRLKMHLQRALVVLALLNFA
TVSLSMSTCTTLDFNHIKRKRVEAIRGQILSKLRLTSPPDPSGLASVPIQVLDLYNSTRE
LLEEVHGERGDVCTQANTESEYYAKEIYKFDMIQGLEEHNDLTVCPKGITSKIFRFNVSS
VEKNETNLFRAEFRVFRMPNPASKRSEQRIELFQILQPGEHIAKQRYIDGKNLPTRGTGE
WLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIQELMEIKFKGVDSDDD
PGRGDLGRLKKKKEHIPHLILMMIPPNRLDSPGHSQRKKRALDTNYCFRNLEENCCVRPL
YIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSSDTTHSTVLGLYNTLNPEASASPCCVP
QDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcctggttttcctcc
ctccttctgcacgactgccggggtctcctcctgccaggccttgcggcctttctccccggc
ccccgcctgaagatgcacttgcagagggctctggtggtcctggccctgctgaactttgcc
acggtcagcctctccatgtccacttgcaccaccttggacttcaaccacatcaagaggaag
cgggtggaagccattaggggacagatcttgagcaaactcaggctcaccagtccccccgat
ccatccgggttggccagtgtccccatccaggtcctggatctttacaacagcacccgagag
ctactggaggaggtgcatggggagaggggagacgtctgcacgcaagcaaacaccgagtcg
gagtattatgccaaagaaatctataaattcgacatgatccaggggctggaggagcacaat
gacctgaccgtctgcccgaaaggcatcacctccaagattttccgcttcaacgtgtcctca
gtggagaaaaacgaaaccaacctgttccgagcagaattccgggtctttcggatgcccaac
cctgcctccaagcgcagcgagcagaggattgagctcttccagatcctccagccgggtgag
cacatagccaagcagcggtatatcgatggcaagaacctgcccacgcggggcactggcgag
tggctgtctttcgacgtcacagacactgtgcgtgaatggctcttgcggagagaatccaac
ttaggtctggaaatcagcatccactgtccctgtcacacctttcagcccaatggggatatc
ctggaaaacattcaagagctgatggaaatcaaattcaaaggtgtggacagcgatgatgat
ccgggccgcggagatctggggcgacttaagaagaagaaggaacacatccctcatctaatc
ctcatgatgattcccccaaaccggctagacagcccaggccacagtcagaggaagaagcgg
gccctggacaccaattactgcttccgcaatttggaggagaactgctgtgtgcgtcctctc
tacattgacttccgacaggatctgggctggaaatgggtccatgaacctaagggctactat
gccaacttctgctcaggcccatgcccatacctccgcagctcagacacaacccacagcacg
gtgctgggcttgtacaacactctgaaccctgaagcctcagcctccccttgctgcgtaccc
caggacttggagcccctgaccatcctgtactatgtcgggaggacccccaaagtggagcag
ctgtctaacatggtggtgaagtcctgcaagtgcagctga

KEGG   Bos indicus (zebu cattle): 109570509
Entry
109570509         CDS       T04792                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04218  Cellular senescence
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04390  Hippo signaling pathway
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05410  Hypertrophic cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570509 (TGFB2)
   04350 TGF-beta signaling pathway
    109570509 (TGFB2)
   04390 Hippo signaling pathway
    109570509 (TGFB2)
   04068 FoxO signaling pathway
    109570509 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109570509 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109570509 (TGFB2)
   04218 Cellular senescence
    109570509 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109570509 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109570509 (TGFB2)
   05206 MicroRNAs in cancer
    109570509 (TGFB2)
   05205 Proteoglycans in cancer
    109570509 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109570509 (TGFB2)
   05212 Pancreatic cancer
    109570509 (TGFB2)
   05225 Hepatocellular carcinoma
    109570509 (TGFB2)
   05226 Gastric cancer
    109570509 (TGFB2)
   05220 Chronic myeloid leukemia
    109570509 (TGFB2)
   05211 Renal cell carcinoma
    109570509 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109570509 (TGFB2)
   05321 Inflammatory bowel disease
    109570509 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109570509 (TGFB2)
   05414 Dilated cardiomyopathy
    109570509 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    109570509 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109570509 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109570509 (TGFB2)
   05161 Hepatitis B
    109570509 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109570509 (TGFB2)
   05144 Malaria
    109570509 (TGFB2)
   05145 Toxoplasmosis
    109570509 (TGFB2)
   05140 Leishmaniasis
    109570509 (TGFB2)
   05142 Chagas disease
    109570509 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109570509 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109570509 (TGFB2)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109570509 (TGFB2)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109570509 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 109570509
NCBI-ProteinID: XP_019832070
UniProt: A0A6P5D2G4
LinkDB
Position
16
AA seq 442 aa
MHYCVLSAFLLLHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPSFLPSETVCPV
VTTPSGSVGSLCSRQSQVFCGYLDAIPPTFYRPYFRIVRFDVSSMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKSPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcgtttctgctcctgcatctggtcacggtcgcgctcagc
ctgtctacctgcagcacgctcgacatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccagaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctccaggag
aaggcgagccggagggcggccgcctgcgagcgcgagcggagcgacgaggaatactacgcc
aaggaggtttacaaaatagacatgccgtccttcttaccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttgtgctccagacagtcccaggttttctgt
gggtaccttgatgccatcccgcccactttctacagaccgtactttagaattgtccgattt
gacgtctcctcgatggagaagaatgcttccaatttggtgaaggccgagttcagagtcttt
cgtttacagaacccaaaagccagagtgcctgaacaacggatcgagctgtatcagattctc
aaatccaaagatttaacatctccaacccagcgctacattgacagcaaagtcgtgaaaacc
agagcagagggtgaatggctctccttcgacgtcactgatgctgttcacgaatggctccac
cataaagacaggaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatcgaataattacatcatccccaataaaagtgaagaactagaagcacgctttgcaggt
attgatggcacctctacctataccagtggtgatcagaaaacaataaagtccactaggaaa
aaaaacagtgggaagagcccacatctcctgctaatgttgttgccctcctacagacttgag
tcccaacagtccaaccggcggaagaagcgcgctctggatgcagcctattgctttagaaat
gtgcaggataattgttgcctacgcccactttacattgatttcaagagggatcttgggtgg
aaatggattcatgagcctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ctgtggagctcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcgtctgcttccccttgctgcgtgtcccaagatttagagccgctcaccattctctac
tacattggcaaaacacccaagatcgaacagctttctaatatgattgtcaagtcttgcaaa
tgcagctaa

KEGG   Bos indicus (zebu cattle): 109572866
Entry
109572866         CDS       T04792                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04068  FoxO signaling pathway
biu04110  Cell cycle
biu04218  Cellular senescence
biu04350  TGF-beta signaling pathway
biu04380  Osteoclast differentiation
biu04390  Hippo signaling pathway
biu04659  Th17 cell differentiation
biu04672  Intestinal immune network for IgA production
biu04926  Relaxin signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05144  Malaria
biu05145  Toxoplasmosis
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05161  Hepatitis B
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05410  Hypertrophic cardiomyopathy
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109572866 (TGFB1)
   04350 TGF-beta signaling pathway
    109572866 (TGFB1)
   04390 Hippo signaling pathway
    109572866 (TGFB1)
   04068 FoxO signaling pathway
    109572866 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109572866 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109572866 (TGFB1)
   04218 Cellular senescence
    109572866 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    109572866 (TGFB1)
   04672 Intestinal immune network for IgA production
    109572866 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    109572866 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109572866 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109572866 (TGFB1)
   05205 Proteoglycans in cancer
    109572866 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109572866 (TGFB1)
   05212 Pancreatic cancer
    109572866 (TGFB1)
   05225 Hepatocellular carcinoma
    109572866 (TGFB1)
   05226 Gastric cancer
    109572866 (TGFB1)
   05220 Chronic myeloid leukemia
    109572866 (TGFB1)
   05211 Renal cell carcinoma
    109572866 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109572866 (TGFB1)
   05321 Inflammatory bowel disease
    109572866 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    109572866 (TGFB1)
   05414 Dilated cardiomyopathy
    109572866 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109572866 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109572866 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    109572866 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109572866 (TGFB1)
   05161 Hepatitis B
    109572866 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109572866 (TGFB1)
   05144 Malaria
    109572866 (TGFB1)
   05145 Toxoplasmosis
    109572866 (TGFB1)
   05140 Leishmaniasis
    109572866 (TGFB1)
   05142 Chagas disease
    109572866 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:biu03110]
    109572866 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109572866 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109572866 (TGFB1)
Chaperones and folding catalysts [BR:biu03110]
 Intramolecular chaperones
  Others
   109572866 (TGFB1)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   109572866 (TGFB1)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   109572866 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 109572866
NCBI-ProteinID: XP_019835568
UniProt: A0A6P5DB61
LinkDB
Position
18
AA seq 338 aa
MPPSGLRLLPLLLPLLWLLMLTPGRPVARLSTCKTIDMELVKRKPEPEADYYAKEVTRVL
MVEYGNKIYDKMKSSSHSIYMFFNTSELREAVPEPVLLSRAELRLLRLKLKVEQHVELYQ
KYSNNSWRYLSNRLLAPSDSPEWLSFDVTGVVRQWLTRREEIEGFRLSAHCSCDSKDNTL
QVDINGFSSGRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKN
CCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASA
APCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgctgctgctgccgctgctgtggctactaatg
ctgacgcctggccggccggtcgctcggctgtccacctgcaagaccatcgacatggagctg
gtgaagcggaagcctgagccagaggcggactactacgccaaggaggtcacccgcgtgcta
atggtggaatacggcaacaaaatctatgacaaaatgaagtctagctcgcacagcatatat
atgttcttcaacacgtccgagctccgggaagcggtgcccgaacctgtgttgctctctcgg
gcagagctgcgcctgctgaggctcaagttaaaagtggagcagcacgtggagctgtaccag
aaatatagcaacaattcctggcgctacctcagcaaccggctgctcgcccccagcgactca
ccggagtggctgtcctttgacgtcactggagttgtgcggcagtggctgacccgcagagag
gaaatagagggctttcgcctcagtgcccactgttcctgtgacagtaaagataacacgctt
caagtggacattaacgggttcagttccggccgccggggtgacctcgccaccattcacggc
atgaaccggcccttcctgctcctcatggccacccctctggagagggcccagcacctgcac
agctcccgccaccgccgagccctggacaccaactactgcttcagctccacagaaaagaac
tgctgtgttcgtcagctctacattgacttccggaaggacctgggctggaagtggattcat
gaacccaaggggtaccacgccaatttctgcctggggccctgcccttacatctggagcctg
gatacacagtacagcaaggtcctggccctgtacaaccagcacaacccgggcgcttcggcg
gcgccgtgctgcgtgcctcaggcgctggagcccctgcccatcgtgtactacgtgggccgc
aagcccaaggtggagcagttgtccaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system