KEGG   Bos indicus (zebu cattle): 109565389
Entry
109565389         CDS       T04792                                 

Gene name
SNW1
Definition
(RefSeq) LOW QUALITY PROTEIN: SNW domain-containing protein 1
  KO
K06063  SNW domain-containing protein 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03040  Spliceosome
biu04330  Notch signaling pathway
biu05169  Epstein-Barr virus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109565389 (SNW1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    109565389 (SNW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109565389 (SNW1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109565389 (SNW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:biu03041]
    109565389 (SNW1)
Spliceosome [BR:biu03041]
 Complex B
  Other components
   Prp19-related factors
    109565389 (SNW1)
 Complex C
    109565389 (SNW1)
SSDB
Motif
Pfam: SKIP_SNW
Other DBs
NCBI-GeneID: 109565389
NCBI-ProteinID: XP_019824878
UniProt: A0A6P5CHC6
LinkDB
Position
10
AA seq 536 aa
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDAEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQNIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt   +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctgtctcaggaccagcttgaagct
gaagaaaaggcacgatcccagagatcacgacagacctcactggtctcctcccgaagagag
cctcccccatatggttaccggaaaggctggatacctcggttattagaggattttggagat
ggaggggcttttccagagatccacgtggcccagtatcccctggatatgggacgaaagaaa
aaaatgtcaaatgcattggccattcaggtggatgctgaaggaaaaattaagtatgatgca
attgctcgacaaggacagtcaaaagacaaggtcatttatagcaagtacactgacctggtt
cccaaagaagtcatgaatgcagatgacccagaccttcaaagacctgatgaagaagccatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcgcagaaggttgca
gcagccatgccagtccgagcagctgataaactggctcctgctcagtatatccgatacaca
ccatctcaacaaggagtggctttcaactctggcgctaaacagagagttattcggatggtg
gaaatgcagaaagatccaatggagcctccaaggttcaagattaataagaaaattcctcgg
ggaccaccttctcctcctgcacctgtcatgcattctcctagccgaaagatgaccgtgaag
gagcagcaagagtggaagattcctccatgtatttcaaactggaaaaatgcaaagggttat
acaattccattagataaacgtctggctgccgatggaagaggactgcagacagttcacatc
aatgaaaattttgcaaaactggccgaagccctctacattgctgatcgaaaggctcgtgaa
gcagtggaaatgcgtgctcaagtagagagaaagatggctcaaaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagagagagaagagctgggatcaaaacc
catgtggaaaaagaggacggggaggcacgtgagagggatgaaatccggcatgaccggcga
aaagagagacagcatgaccggaacctctccagggcagctccagacaagaggtcgaaactg
cagagaaatgaaaatcgagacatcagtgaagtcattgctcttggtgtgcccaaccctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccagtccaagggtatggacagt
ggttttgcaggtggagaagatgaaatttacaatgtttatgatcaagcctggagaggtgga
aaagatatggcccagaatatttacaggcccagtaaaaatctggacaaggacatgtatgga
gatgacctagaagccagaataaagactaacagatttgttcccgataaggagttttctggt
tcagaccgtagacaaagaggccgagaaggaccagttcagtttgaggaggatcctttcggt
ttggacaaatttttggaagaagccaagcaacatggtggctctaaaagaccctcagatagc
agccgtcccaaggaacatgagcatgaaggcaaaaagaggaggaaggagtag

DBGET integrated database retrieval system