KEGG   Bos indicus (zebu cattle): 109565431
Entry
109565431         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: beta-2-microglobulin-like
  KO
K08055  beta-2-microglobulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04612  Antigen processing and presentation
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109565431
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565431
   05170 Human immunodeficiency virus 1 infection
    109565431
   05168 Herpes simplex virus 1 infection
    109565431
   05163 Human cytomegalovirus infection
    109565431
   05169 Epstein-Barr virus infection
    109565431
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109565431
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109565431
SSDB
Motif
Pfam: C1-set Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 109565431
NCBI-ProteinID: XP_019824965
UniProt: A0A6P5CH04
LinkDB
Position
10
AA seq 118 aa
MARFVALVLLGLLSLSGLDAIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLL
KNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEXPRIVKWDRDL
NT seq 357 nt   +upstreamnt  +downstreamnt
atggctcgcttcgtggccttggtccttctcgggctgctgtcgctgtctggactggacgcc
atccagcgtcctccaaagattcaagtgtactcaagacacccaccagaagatggaaagcca
aattacctgaactgctatgtgtatgggttccatccaccccagattgaaatcgatttgctg
aagaatggggagaagattaaatcggagcagtcagacctgtctttcagcaaggactggtct
ttctacctgctgtcccacgctgagttcactcccaacagcaaggatcagtacagctgccga
gtgaaacacgttactttggaancaccccggatagttaagtgggatcgagacctgtaa

KEGG   Bos indicus (zebu cattle): 109565432
Entry
109565432         CDS       T04792                                 

Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04612  Antigen processing and presentation
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    109565432
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565432
   05170 Human immunodeficiency virus 1 infection
    109565432
   05168 Herpes simplex virus 1 infection
    109565432
   05163 Human cytomegalovirus infection
    109565432
   05169 Epstein-Barr virus infection
    109565432
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109565432
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   109565432
SSDB
Motif
Pfam: C1-set Ig_3 Ig_2 I-set
Other DBs
NCBI-GeneID: 109565432
NCBI-ProteinID: XP_019824966
UniProt: A0A6P5CGB4
LinkDB
Position
10
AA seq 118 aa
MARFVALVLLGLLSLSGLDAIQRPPKIQVYSRHPPEDGKPNYLNCYVYGFHPPQIEIDLL
KNGEKIKSEQSDLSFSKDWSFYLLSHAEFTPNSKDQYSCRVKHVTLEQPRIVKWDRDL
NT seq 357 nt   +upstreamnt  +downstreamnt
atggctcgcttcgtggccttggtccttctcgggctgctgtcgctgtctggactggacgcc
atccagcgtcctccaaagattcaagtgtactcaagacacccaccagaagatggaaagcca
aattacctgaactgctatgtgtatgggttccatccaccccagattgaaatcgatttgctg
aagaatggggagaagattaaatcggagcagtcagacctgtctttcagcaaggactggtct
ttctacctgctgtcccacgctgagttcactcccaacagcaaggatcagtacagctgccga
gtgaaacacgttactttggaacaaccccggatagttaagtgggatcgagacctgtaa

DBGET integrated database retrieval system