KEGG   Bos indicus (zebu cattle): 109565502
Entry
109565502         CDS       T04792                                 

Gene name
IL1R1
Definition
(RefSeq) interleukin-1 receptor type 1
  KO
K04386  interleukin 1 receptor type I
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04064  NF-kappa B signaling pathway
biu04380  Osteoclast differentiation
biu04640  Hematopoietic cell lineage
biu04659  Th17 cell differentiation
biu04750  Inflammatory mediator regulation of TRP channels
biu05146  Amoebiasis
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109565502 (IL1R1)
   04064 NF-kappa B signaling pathway
    109565502 (IL1R1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109565502 (IL1R1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109565502 (IL1R1)
   04659 Th17 cell differentiation
    109565502 (IL1R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109565502 (IL1R1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109565502 (IL1R1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109565502 (IL1R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565502 (IL1R1)
   05163 Human cytomegalovirus infection
    109565502 (IL1R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109565502 (IL1R1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109565502 (IL1R1)
   04090 CD molecules [BR:biu04090]
    109565502 (IL1R1)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL1 receptor family
   109565502 (IL1R1)
CD molecules [BR:biu04090]
 Proteins
  109565502 (IL1R1)
SSDB
Motif
Pfam: TIR Ig_3 Ig_2 Ig_6 I-set ig Ig_5 Adeno_E3_CR1 V-set TIR_2
Other DBs
NCBI-GeneID: 109565502
NCBI-ProteinID: XP_019824997
UniProt: A0A6P5CJD2
LinkDB
Position
11
AA seq 558 aa
MLVNFYKCEEHEEKITLVSPAREIDARSCPLITSAHKEPITWYKNDSTTPVSTERGSRIH
QHKDKLWFVPAEVEDSGAYYCSVRNSTYCLKIKIVVEFVQHEPNLCYNERTVFTQRLLTA
GDGQLVCPYLDFLKDENNELPQVQWYKDCKPLLLDNVNFAGVTNKLIITNVNTAHSGHYM
CHASYTHLGKQYRVTRAIKLITLEKSRNTKPEIVSPANETMEVVLGSWLQLICNVTGRLS
NYVYWKWNGSMVSTYTPVLEEDFITVENPLNRRRSTVLARLNISAVESKFFLHPFTCLAK
NTEGISTAYIQLIHPVPDFQKPTVGIFVMLTLVITCSVCIYKVFKVDIVLWYRDSFYDFL
PKKVSDGKTYDAYILCPKTPGEGSTCNSDIFVFKVMPEVLEKQCGYKLFICGRDDYVGES
IVEVVNENVKKSRRLIIILVPETSGFSWPGNSSEEQVAMYNALIQEGIKVVLLELEKIPD
YEKMPESIKFIKQKQGVIRWSGDFREGSQSMNSRFWKKVRYHMPVQRQRRLSKHQLLSPA
TLLDSKEKRPMEVHVPLG
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgttggttaacttctataaatgtgaggaacatgaagagaaaattacgctggtttcaccc
gcacgtgaaatcgatgctcgctcgtgtcctctcatcacaagtgcccacaaagagcctata
acttggtataaaaatgacagcacgacgcctgtatctacagaaagaggatctcggattcac
cagcacaaagacaagctctggtttgttcctgctgaagtggaggattcaggagcttactat
tgctcagtgagaaattcaacttactgcctcaaaattaaaatagtggtagagtttgtgcag
cacgagcctaacttgtgttacaatgaaaggactgtgtttacccagagactgctgaccgcg
ggagacggacaacttgtatgtccttacttggattttttaaaagatgaaaacaatgagtta
ccccaagtacagtggtataaggactgcaaacctctacttcttgacaacgtaaactttgct
ggagtaacaaataagctgatcatcacaaacgtgaacacagcacacagtgggcactatatg
tgtcatgcgtcatacacacacttgggaaagcagtatcgtgtcacccgggcgataaagctg
attactctggagaaatccagaaacacaaaacctgagattgtgagtccagctaatgagaca
atggaagtggtcttgggatcctggcttcaattgatctgcaatgttactggccggctaagt
aactatgtctattggaagtggaatgggtcgatggttagtacatacactcctgtgctagag
gaagactttatcacagtggagaatcctttaaacagaagaaggagtacagtcctcgcacgg
cttaatatttcggcagtggaaagtaaatttttcctgcatccatttacctgtttagccaag
aatacagaaggaataagcacagcatacatacaactaatacatccagtccccgatttccag
aagcccacagttggtatattcgtcatgttaacattggtaattacatgctctgtttgcatc
tacaaagtcttcaaggttgacattgtgctttggtacagagattccttctatgatttcctc
ccgaaaaaagtttcagatggaaagacatatgatgcatacatactatgtccaaagacccct
ggggaagggtccacctgtaactcggatatttttgtgtttaaagtcatgcctgaggtcttg
gaaaaacagtgtggctataagctgttcatctgtggccgagatgactacgttggggaaagc
attgttgaggttgttaatgaaaatgtaaagaaaagcaggaggctgattatcattttggtc
ccagaaacgtcaggattcagctggccggggaattcatctgaagagcaggtggccatgtac
aatgctctcattcaggaaggaattaaagtcgtcctattggagctggagaagattccagac
tatgagaaaatgccagaatccattaaattcattaagcagaaacagggggtcatacgctgg
tcaggggactttagagaggggtcgcagtctatgaactcgagattctggaagaaggtcagg
taccacatgccagtccagcggcagcggcgtttatccaagcaccagctgctgtccccggcc
actctgctggactctaaggagaaacgacccatggaggtccacgtgcctctcgggtag

KEGG   Bos indicus (zebu cattle): 109565866
Entry
109565866         CDS       T04792                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04640  Hematopoietic cell lineage
biu05146  Amoebiasis
biu05166  Human T-cell leukemia virus 1 infection
biu05202  Transcriptional misregulation in cancer
biu05215  Prostate cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109565866 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109565866 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    109565866 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    109565866 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109565866 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565866 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109565866 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109565866 (IL1R2)
   04090 CD molecules [BR:biu04090]
    109565866 (IL1R2)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL1 receptor family
   109565866 (IL1R2)
CD molecules [BR:biu04090]
 Proteins
  109565866 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Ig_5 Ig_4 Izumo-Ig
Other DBs
NCBI-GeneID: 109565866
NCBI-ProteinID: XP_019825381
UniProt: A0A6P5CHE3
LinkDB
Position
11
AA seq 400 aa
MFLLSVLIMGVSTFAVQSEEHSVAAGSCRFHGRHPKTRFKVEGEPLVLTCPQVLHWESTS
AHVNVTWRRNDSAVAVPGEEESRVWVRDGALWIVPASQADSGTYICTVRNASYCDKMSVE
LRVFEKTDASVPLIFYPQIIPLSASGLLVCPDLSEFIGNRTDVEIQWYKDSVPLDQDNQK
FLNVRGTRLLVNNVSXEDAGYYTCAMTYAHKGRQYNITRNIKLRVKKRDEETIPVIISPH
QTISASLGSRLTIPCKVFLGAGIHTTTLLWWTANNTFIEDAYHGGRVTEGERQAYSENNE
NYIEVPLIFDPVRREDLHTDFKCVVRNTMSSQTLRTTVKEAATFSWEIMLAPLSLIVLVL
GGIWMHRRYKRRTGKAYGLMELKTGHPDSQSYPSKIKEIK
NT seq 1203 nt   +upstreamnt  +downstreamnt
atgttcctcttgtccgtattgataatgggtgtgtccaccttcgctgtgcagtctgaggag
cactcggtggccgcaggaagctgccgatttcatggcaggcaccccaaaacaaggttcaag
gtagaaggggagcctttggtcttgacgtgcccccaagttctccactgggagtctaccagc
gcccatgtcaacgtgacttggcgtagaaatgactccgccgtggcggtcccaggggaagaa
gagtcgcgcgtgtgggtccgagacggagctctctggatcgtgccagcctcccaggcagac
tcgggcacctacatctgcactgtcagaaatgcctcttactgtgacaaaatgtccgttgag
ctcagggttttcgagaagacagacgcctccgtgcctctcatcttctacccacaaattata
cccttgtcagcctctgggctactagtttgtcctgatctgagcgaattcatcggtaacaga
actgacgtggagattcagtggtacaaggattctgtccctttggatcaagacaaccagaag
tttctcaatgtgaggggaactcgcttactcgtaaacaatgtgtccrtggaggacgcaggc
tactatacctgtgccatgacgtatgcccacaaaggcaggcaatacaacatcaccaggaat
atcaaactccgagttaagaaaagagacgaggagactattcctgtgatcatctctccccac
cagaccatctcagcctcactggggtccaggctgacaatcccatgtaaggtgtttctggga
gccggcatacacacaaccactctgctgtggtggacagccaacaacaccttcatagaggat
gcctaccacgggggccgcgtgaccgagggcgagcgccaggcatactcagaaaacaatgag
aactacattgaagtgccactgatttttgatcctgtcagaagagaggatttgcacacggat
tttaagtgtgttgtccgtaatacgatgagttcccagacgcttcgtaccacggtcaaagaa
gctgccacgttctcctgggagatcatgcttgccccgctgtccctcatcgtcttggttctg
gggggcatatggatgcacagacggtataaacgcagaactggaaaagcctatggtttgatg
gagttaaagactggccatccagattcgcaatcctatccgagtaaaataaaggaaataaaa
tag

DBGET integrated database retrieval system