KEGG   Bos indicus (zebu cattle): 109565507
Entry
109565507         CDS       T04792                                 

Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01524  Platinum drug resistance
biu04014  Ras signaling pathway
biu04064  NF-kappa B signaling pathway
biu04115  p53 signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05145  Toxoplasmosis
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109565507
   04630 JAK-STAT signaling pathway
    109565507
   04064 NF-kappa B signaling pathway
    109565507
   04151 PI3K-Akt signaling pathway
    109565507
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109565507
   04137 Mitophagy - animal
    109565507
  09143 Cell growth and death
   04210 Apoptosis
    109565507
   04215 Apoptosis - multiple species
    109565507
   04115 p53 signaling pathway
    109565507
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109565507
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565507
   05202 Transcriptional misregulation in cancer
    109565507
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109565507
   05225 Hepatocellular carcinoma
    109565507
   05220 Chronic myeloid leukemia
    109565507
   05222 Small cell lung cancer
    109565507
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109565507
   05014 Amyotrophic lateral sclerosis
    109565507
   05022 Pathways of neurodegeneration - multiple diseases
    109565507
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109565507
   05170 Human immunodeficiency virus 1 infection
    109565507
   05162 Measles
    109565507
   05168 Herpes simplex virus 1 infection
    109565507
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109565507
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109565507
   01524 Platinum drug resistance
    109565507
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109565507
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109565507
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109565507
SSDB
Motif
Pfam: BH4 Bcl-2 PHINT_rpt DUF3094
Other DBs
NCBI-GeneID: 109565507
NCBI-ProteinID: XP_019825001
UniProt: A0A6P5CGD9
LinkDB
Position
11
AA seq 173 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEXTESDMEIXSAINGNPSWHVA
DSPAVNGAIGHSRSLDARKMIPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAY
QSFEQNGDWDTFVELYENNTTTESQKXQESFNCWSLMDVSVAGVVPLGLLFNS
NT seq 522 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaycgggaactagtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatatggaagagaacagaactgagaccccagaakgg
acagaatcagatatggaaatccscagtgccatcaatggcaacccatcctggcaygtggca
gatagccctgcagtgaatggagccattggccacagcagaagcttggaygcccggaaaatg
atcccyatgacaacagtaaagcaagccctgagggaggcaagcaatgagtttgaactgagg
taccaacagacattcagcgacctgacrtcccagctccacatcaccccagggacagcgtat
cagagctttgaacagaatggtgactgggacacttttgtggaactctacgaaaacaataca
acaacagagagccaaaagrgtcaagagagcttcaactgctggtccctgatggacgtgagt
gtggctggtgtggttccactgggcttgctcttcaactcataa

KEGG   Bos indicus (zebu cattle): 109567345
Entry
109567345         CDS       T04792                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu01524  Platinum drug resistance
biu04014  Ras signaling pathway
biu04064  NF-kappa B signaling pathway
biu04115  p53 signaling pathway
biu04137  Mitophagy - animal
biu04140  Autophagy - animal
biu04151  PI3K-Akt signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04621  NOD-like receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu05012  Parkinson disease
biu05014  Amyotrophic lateral sclerosis
biu05022  Pathways of neurodegeneration - multiple diseases
biu05145  Toxoplasmosis
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05168  Herpes simplex virus 1 infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05212  Pancreatic cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109567345 (BCL2L1)
   04630 JAK-STAT signaling pathway
    109567345 (BCL2L1)
   04064 NF-kappa B signaling pathway
    109567345 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    109567345 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109567345 (BCL2L1)
   04137 Mitophagy - animal
    109567345 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    109567345 (BCL2L1)
   04215 Apoptosis - multiple species
    109567345 (BCL2L1)
   04115 p53 signaling pathway
    109567345 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109567345 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567345 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    109567345 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109567345 (BCL2L1)
   05225 Hepatocellular carcinoma
    109567345 (BCL2L1)
   05220 Chronic myeloid leukemia
    109567345 (BCL2L1)
   05222 Small cell lung cancer
    109567345 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109567345 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    109567345 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    109567345 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567345 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    109567345 (BCL2L1)
   05162 Measles
    109567345 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    109567345 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109567345 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109567345 (BCL2L1)
   01524 Platinum drug resistance
    109567345 (BCL2L1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109567345 (BCL2L1)
Chromosome and associated proteins [BR:biu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    109567345 (BCL2L1)
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109567345 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 109567345
NCBI-ProteinID: XP_019827773
UniProt: A0A6P5CNW9
LinkDB
Position
13
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEXNRTEAPEGTESDMETPSAINGNASWHLA
DSPAVNGATGHSRSSDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIATWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagtaaccgggagctggtggttgactttctctcttacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagakaacagaactgaggccccagaaggg
acagaatcagatatggaaacccccagtgccatcaatggcaacgcatcctggcacctggcg
gatagccctgctgtgaatggagccactggccacagcagaagctcggatgcccgggaagtg
atccccatggcagcggtgaagcaagccctgagggaggcaggcgatgagtttgaactgagg
taccgacgggcattcagcgacctgacgtcccagctccacatcaccccagggacagcatat
cagagctttgaacaggtagtgaatgaactcttccgggacggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggaaagcgtagacaaggagatgcag
gtattggtgagtcggatcgcaacttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggacacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgcttcaaccgctggttcctgacrggcatgactgtg
gctggtgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system