Bos indicus (zebu cattle): 109565710 Help Entry 109565710         CDS       T04792                                  Gene name BCL2L11 Definition (RefSeq) bcl-2-like protein 11 isoform X1   KO K16341   Bcl-2-like protein 11 Organism biu  Bos indicus (zebu cattle) Pathway biu01521   EGFR tyrosine kinase inhibitor resistance biu04068   FoxO signaling pathway biu04151   PI3K-Akt signaling pathway biu04210   Apoptosis biu04215   Apoptosis - multiple species biu04932   Non-alcoholic fatty liver disease biu05169   Epstein-Barr virus infection biu05200   Pathways in cancer biu05206   MicroRNAs in cancer biu05210   Colorectal cancer Brite KEGG Orthology (KO) [BR:biu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     109565710 (BCL2L11)    04151 PI3K-Akt signaling pathway     109565710 (BCL2L11)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109565710 (BCL2L11)    04215 Apoptosis - multiple species     109565710 (BCL2L11)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     109565710 (BCL2L11)    05206 MicroRNAs in cancer     109565710 (BCL2L11)   09162 Cancer: specific types    05210 Colorectal cancer     109565710 (BCL2L11)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     109565710 (BCL2L11)   09172 Infectious disease: viral    05169 Epstein-Barr virus infection     109565710 (BCL2L11)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     109565710 (BCL2L11) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bim_N Bclx_interact PMAIP1 Motif Other DBs NCBI-GeneID:  109565710 NCBI-ProteinID:  XP_019825172 UniProt:  A0A6P5CI87 LinkDB All DBs Position 11 AA seq 195 aa AA seqDB search MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQGNPEGEGDRCPQGSPQGPL APPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAF NHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVL LRVLRYIVRLVWRMQ NT seq 588 nt NT seq  +upstreamnt  +downstreamnt atggcaaagcaaccttccgatgtaagttctgagtgtgacagagaaggtggacaattgcag cctgccgagaggcctcctcagctcagacckggggcccccacctctttacagacagagcgg caaggtaatcctgaaggagaaggggaccgctgcccccaaggcagcccacagggcccgctg gccccaccggccagccctggccctttcgctaccagatccccgctcttcatcttcgtgaga agatcctccttgctgtctcgatcctccagtgggtatttctcttttgacacagacaggagc ccggcacccatgagttgtgacaaatccacacagaccccaagccctccttgccaggccttc aaccattatctcagtgcaatggcttccatgaggcagtctcaggctgtacctgcagataca cgcccagagatatggattgcccaagagctacggcgtatcggagacgagtttaatgcatat tacccaagaagggtcttcgtgcgtcaccaggcagttgagggccacccgcaaatggtcctc ttgcgcgtcttgcgctacatcgtgcgtctggtgtggaggatgcagtga

DBGET integrated database retrieval system