KEGG   Bos indicus (zebu cattle): 109565956
Entry
109565956         CDS       T04792                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha isoform X1
  KO
K08774  transforming growth factor, alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01521  EGFR tyrosine kinase inhibitor resistance
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04915  Estrogen signaling pathway
biu05200  Pathways in cancer
biu05210  Colorectal cancer
biu05211  Renal cell carcinoma
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05223  Non-small cell lung cancer
biu05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109565956 (TGFA)
   04012 ErbB signaling pathway
    109565956 (TGFA)
   04014 Ras signaling pathway
    109565956 (TGFA)
   04151 PI3K-Akt signaling pathway
    109565956 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    109565956 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109565956 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109565956 (TGFA)
   05212 Pancreatic cancer
    109565956 (TGFA)
   05225 Hepatocellular carcinoma
    109565956 (TGFA)
   05214 Glioma
    109565956 (TGFA)
   05211 Renal cell carcinoma
    109565956 (TGFA)
   05215 Prostate cancer
    109565956 (TGFA)
   05223 Non-small cell lung cancer
    109565956 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    109565956 (TGFA)
SSDB
Motif
Pfam: EGF_2 EGF TMEM154
Other DBs
NCBI-GeneID: 109565956
NCBI-ProteinID: XP_019825520
LinkDB
Position
11
AA seq 160 aa
MVTSAGQLALFALGIFLAVCQALENSTSALSADPPVAAAVVSHFNDCPDSHSQFCFHGTC
RFLVQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVL
IHCCEVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctcttcgcgctgggtattttcttggccgtgtgc
caggccctggagaacagcacatccgccctgagtgcagacccgcccgtggctgcagctgtg
gtgtcccattttaatgactgcccagattcccacagtcagttctgcttccatggaacctgc
aggtttttggtgcaggaggagaagccagcgtgtgtctgccactctgggtacgtcggtgca
cgctgtgaacacgcagacctcctggccgtggtggctgccagccagaagaagcaggccatc
accgccttggtggtggtctccatcgtggccctggctgtcctcatcatcacatgtgtgctg
atacactgctgcgaggtccgaaaacactgtgagtggtgccgggcgctcatctgccggcat
gagaagcccagcgccctcctgaagggaaggactgcttgctgccactcagaaacagtggtc
tga

DBGET integrated database retrieval system