KEGG   Bos indicus (zebu cattle): 109565977
Entry
109565977         CDS       T04792                                 

Gene name
EIF2AK2
Definition
(RefSeq) interferon-induced, double-stranded RNA-activated protein kinase
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04141  Protein processing in endoplasmic reticulum
biu04217  Necroptosis
biu05010  Alzheimer disease
biu05160  Hepatitis C
biu05162  Measles
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05171  Coronavirus disease - COVID-19
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109565977 (EIF2AK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109565977 (EIF2AK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109565977 (EIF2AK2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109565977 (EIF2AK2)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109565977 (EIF2AK2)
   05171 Coronavirus disease - COVID-19
    109565977 (EIF2AK2)
   05164 Influenza A
    109565977 (EIF2AK2)
   05162 Measles
    109565977 (EIF2AK2)
   05168 Herpes simplex virus 1 infection
    109565977 (EIF2AK2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109565977 (EIF2AK2)
   05169 Epstein-Barr virus infection
    109565977 (EIF2AK2)
   05165 Human papillomavirus infection
    109565977 (EIF2AK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109565977 (EIF2AK2)
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109565977 (EIF2AK2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109565977 (EIF2AK2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109565977 (EIF2AK2)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   109565977 (EIF2AK2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109565977 (EIF2AK2)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     109565977 (EIF2AK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr dsrm Kdo DND1_DSRM ABC1 Kinase-like
Other DBs
NCBI-GeneID: 109565977
NCBI-ProteinID: XP_019825552
UniProt: A0A6P5CKY8
LinkDB
Position
11
AA seq 533 aa
MATGRSPCFYIEELNKYQQKNGVEVRYCELAKTGPPHNFRFTYQVIIDDKEYPKAEGRSK
KEAKNAAAKLALEIINKDRKSVSFSSQLTTNIPEGPPIENYIGRLNTISQKKNLCVTYEE
CKSKGDGPEGFHYICKIGQEEYGSGVGSTKQEAKQLAAKLAYEKIESETMRDGFSAACGD
VERNSPAVSTSSSESPSENGFSTNASERSDNNSGTLNSSSVSPGDGSRNNSRKVKRSLAP
TFVSPVKTEGNIYSVNXRLXNDFTEVTPIGSGGFGQVFKAKHRIDKKTYVIKCVKYNSEK
VEREVKALATLNHPNIVHYHNCWDGHDYDPEQSLNSSRSKTRCLFIQMEYCDKGTLDQWI
EKRRGKKPDKRLALDFFQQITTGVHYIHSEQLIHRDLKPGNIFLVAMNQIKIGDFGLVTY
LKNDETRTSKKGTLRYMSPEQLSSVKDYGNEVDIYALGLILAELLHICLTSLETQKFFDD
LRNGRLDVFDDKEKDLLEKLLSVDPKKRPTASEILKTLKEWNNVTEKKKRNTC
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggccactggtcgttcaccatgtttctacatagaagaacttaataaataccaacaaaag
aacggtgtagaagttaggtattgtgaactggctaagacaggacctccacataattttagg
tttacatatcaagttataatagatgataaagaatatccaaaggctgaaggtagatcaaag
aaggaagccaaaaacgctgcagccaaattagctttggaaataattaataaagaccgtaag
tcagttagtttttcatctcagctgacaacaaatattccagaaggaccacccattgagaat
tacataggccgtcttaatacgatctcccagaagaaaaacctatgtgtaacttatgaagaa
tgtaaatcaaagggtgatgggcccgaaggatttcattatatatgcaaaattggacaagaa
gaatatggtagtggtgtgggttccactaaacaggaggcaaaacagttggctgccaaactg
gcttatgaaaagatagaatcagaaacaatgagagatggtttcagtgctgcgtgtggtgat
gtcgaaagaaactctccagcagtgagtacgtctagttctgaatcaccgtctgaaaatggc
ttctcaacaaatgcatcagaaagaagtgataacaacagtggcacattaaacagctcttcc
gtgtctccaggggayggttccagaaataattccaggaaggtgaagagaagtttggcgcct
acatttgtctctcctgtgaagacagaaggaaacatttatagtgtgaacgwaaggttrktc
aacgatttcacagaagtaacaccaattggytcaggtggatttggccaagttttcaaagcc
aaacacagaattgataagaagacttatgttattaaatgtgttaaatataatagtgagaag
gtggagcgtgaagtgaaagctttggcaacacttaatcatccaaatattgttcattaccac
aattgttgggatgggcatgattatgatcctgagcaaagcttaaattcttcaagatcaaag
actaggtgccttttcatccagatggaatattgtgataaaggtacgttggaccaatggatt
gagaaaagaagaggcaagaagccagacaaacgtttggctttggatttctttcaacaaata
acaacaggagtgcattatatacattcagaacagttaattcatagagaccttaagccaggt
aacatatttttagtagctatgaaccaaatcaagattggagactttggacttgttacatac
ctgaaaaatgatgaaacgcggacaagtaaaaagggaactttacgatacatgagcccagaa
cagctttcttctgtgaaagactatggaaatgaagtggacatctatgctttggggctgatt
cttgcagaacttcttcatatatgtctcacttctttagaaacacagaagttctttgacgat
ctaaggaatggcagattagatgtatttgacgacaaagaaaaagatcttctggagaaatta
ctctcagtggaccccaagaaacgacctaccgcatctgagatactgaaractttgaaggag
tggaataatgttacagaaaaaaagaaacgaaacacatgttag

DBGET integrated database retrieval system