KEGG   Bos indicus (zebu cattle): 109566132
Entry
109566132         CDS       T04792                                 

Gene name
IL1A
Definition
(RefSeq) interleukin-1 alpha
  KO
K04383  interleukin 1 alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04217  Necroptosis
biu04218  Cellular senescence
biu04380  Osteoclast differentiation
biu04640  Hematopoietic cell lineage
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04940  Type I diabetes mellitus
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05133  Pertussis
biu05140  Leishmaniasis
biu05152  Tuberculosis
biu05162  Measles
biu05164  Influenza A
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05332  Graft-versus-host disease
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109566132 (IL1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109566132 (IL1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109566132 (IL1A)
   04218 Cellular senescence
    109566132 (IL1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566132 (IL1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109566132 (IL1A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109566132 (IL1A)
   05321 Inflammatory bowel disease
    109566132 (IL1A)
   05332 Graft-versus-host disease
    109566132 (IL1A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566132 (IL1A)
   05020 Prion disease
    109566132 (IL1A)
   05022 Pathways of neurodegeneration - multiple diseases
    109566132 (IL1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109566132 (IL1A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109566132 (IL1A)
   04932 Non-alcoholic fatty liver disease
    109566132 (IL1A)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109566132 (IL1A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    109566132 (IL1A)
   05152 Tuberculosis
    109566132 (IL1A)
  09172 Infectious disease: viral
   05164 Influenza A
    109566132 (IL1A)
   05162 Measles
    109566132 (IL1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    109566132 (IL1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109566132 (IL1A)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109566132 (IL1A)
SSDB
Motif
Pfam: IL1_propep IL1 DUF4937
Other DBs
NCBI-GeneID: 109566132
NCBI-ProteinID: XP_019825812
UniProt: A0A6P5CLP5
LinkDB
Position
11
AA seq 268 aa
MAKVPDLFEDLKNCYSENEDYTSEIDHLSLNQKSFYDASYEPLREDQMNKFMSLDTSETS
KTSKLSFKENVVMVAASGKILKKRRLSLNQFITDDDLEAIANNTEEEIIKPRSAHYSFQS
NVKYNFMRVIHQECILNDALNQSIIRDMSGPYLTATTLNNLEEAVKFDMVAYVSEEDSQL
PVTLRISKTQLFVSAQNEDEPVLLKEMPETPKIIKDETNLLFFWEKHGSMDYFKSVAHPK
LFIATKQEKLVHMASGPPSITDFQILEK
NT seq 807 nt   +upstreamnt  +downstreamnt
atggccaaagtccctgacctctttgaagacctgaagaactgttacagtgaaaatgaagac
tacacttctgaaattgaccacctctctctcaatcagaagtccttctatgatgcaagctat
gagccacttcgtgaggaccagatgaataagtttatgtccctggatacctcggaaacctct
aagacatccaagcttagcttcaaggagaatgtggtgatggtggcagccagtgggaagatt
ctgaagaagagacggttgagtttaaatcagttcatcaccgatgatgacctggaagccatt
gccaataacacagaagaagaaatcatcaagcccagatcagcacattacagcttccagagt
aacgtgaaatacaactttatgagagtcatccaccaggaatgcatcctgaacgacgccctc
aatcaaagtataattcgagatatgtcaggtccatacctgacggctactacattaaataat
ctggaggaggcagtgaaatttgacatggttgcttatgtatcagaagaggattctcagctt
cctgtgactctaagaatctcaaaaactcaactgtttgtgagtgctcaaaatgaagacgaa
cccgtcttgctaaaggagatgcctgagacacccaaaatcatcaaagatgagaccaacctc
ctcttcttctgggaaaagcatggctctatggactacttcaaatcagttgcccatccaaag
ttgtttattgccacaaagcaagaaaaattggtgcacatggcaagtgggccgccctcgatc
actgactttcagatattggaaaaatag

KEGG   Bos indicus (zebu cattle): 109566133
Entry
109566133         CDS       T04792                                 

Gene name
IL1B
Definition
(RefSeq) interleukin-1 beta
  KO
K04519  interleukin 1 beta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01523  Antifolate resistance
biu04010  MAPK signaling pathway
biu04060  Cytokine-cytokine receptor interaction
biu04064  NF-kappa B signaling pathway
biu04217  Necroptosis
biu04380  Osteoclast differentiation
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04623  Cytosolic DNA-sensing pathway
biu04625  C-type lectin receptor signaling pathway
biu04640  Hematopoietic cell lineage
biu04657  IL-17 signaling pathway
biu04659  Th17 cell differentiation
biu04668  TNF signaling pathway
biu04750  Inflammatory mediator regulation of TRP channels
biu04932  Non-alcoholic fatty liver disease
biu04933  AGE-RAGE signaling pathway in diabetic complications
biu04940  Type I diabetes mellitus
biu05010  Alzheimer disease
biu05020  Prion disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05133  Pertussis
biu05134  Legionellosis
biu05135  Yersinia infection
biu05140  Leishmaniasis
biu05142  Chagas disease
biu05143  African trypanosomiasis
biu05144  Malaria
biu05146  Amoebiasis
biu05152  Tuberculosis
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05168  Herpes simplex virus 1 infection
biu05171  Coronavirus disease - COVID-19
biu05321  Inflammatory bowel disease
biu05323  Rheumatoid arthritis
biu05332  Graft-versus-host disease
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109566133 (IL1B)
   04064 NF-kappa B signaling pathway
    109566133 (IL1B)
   04668 TNF signaling pathway
    109566133 (IL1B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109566133 (IL1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109566133 (IL1B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109566133 (IL1B)
   04620 Toll-like receptor signaling pathway
    109566133 (IL1B)
   04621 NOD-like receptor signaling pathway
    109566133 (IL1B)
   04623 Cytosolic DNA-sensing pathway
    109566133 (IL1B)
   04625 C-type lectin receptor signaling pathway
    109566133 (IL1B)
   04659 Th17 cell differentiation
    109566133 (IL1B)
   04657 IL-17 signaling pathway
    109566133 (IL1B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109566133 (IL1B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109566133 (IL1B)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    109566133 (IL1B)
   05321 Inflammatory bowel disease
    109566133 (IL1B)
   05332 Graft-versus-host disease
    109566133 (IL1B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109566133 (IL1B)
   05020 Prion disease
    109566133 (IL1B)
   05022 Pathways of neurodegeneration - multiple diseases
    109566133 (IL1B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109566133 (IL1B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    109566133 (IL1B)
   04932 Non-alcoholic fatty liver disease
    109566133 (IL1B)
   04933 AGE-RAGE signaling pathway in diabetic complications
    109566133 (IL1B)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109566133 (IL1B)
   05135 Yersinia infection
    109566133 (IL1B)
   05133 Pertussis
    109566133 (IL1B)
   05134 Legionellosis
    109566133 (IL1B)
   05152 Tuberculosis
    109566133 (IL1B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    109566133 (IL1B)
   05164 Influenza A
    109566133 (IL1B)
   05162 Measles
    109566133 (IL1B)
   05168 Herpes simplex virus 1 infection
    109566133 (IL1B)
   05163 Human cytomegalovirus infection
    109566133 (IL1B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109566133 (IL1B)
   05144 Malaria
    109566133 (IL1B)
   05140 Leishmaniasis
    109566133 (IL1B)
   05142 Chagas disease
    109566133 (IL1B)
   05143 African trypanosomiasis
    109566133 (IL1B)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    109566133 (IL1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109566133 (IL1B)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109566133 (IL1B)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109566133 (IL1B)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109566133 (IL1B)
SSDB
Motif
Pfam: IL1 IL1_propep
Other DBs
NCBI-GeneID: 109566133
NCBI-ProteinID: XP_019825813
UniProt: A0A6P5CJY3
LinkDB
Position
11
AA seq 266 aa
MATVPEPINEMMAYYSDENELLFEADDPKQMKSCIQHLDLGSMGDGNIQLQISHQFYNKS
FRQVVSVIVAMEKLRNSAYAHVFHDDDLRSILSFIFEEEPVIFETSSDEFLCDAPVQSIK
CKLQDREQKSLVLASPCVLKALHLLSQEMNREVVFCMSFVQGEERDNKIPVALGIKDKNL
YLSCVKKGDTPTLQLEEVDPKVYPKRNMEKRFVFYKTEIKNTVEFESVLYPNWYISTSQI
EERPVFLGHFRGGQDITDFRMETLSP
NT seq 801 nt   +upstreamnt  +downstreamnt
atggcaaccgtacctgaacccatcaacgaaatgatggcttactacagtgacgagaatgag
ctgttatttgaggctgatgaccctaaacagatgaagagctgcatccaacacctggacctc
ggttccatgggagatggaaacatccagctgcagatttctcaccagttctacaacaaaagc
ttcaggcaggtggtgtcggtcatygtggccatggagaagctgaggaacagtgcctacgca
catgtcttccatgatgatgacctgaggagcatcctttcattcatctttgaagaagagcct
gtcatcttcgaaacgtcctccgacgagtttctgtgtgacgcacccgtgcagtcaataaag
tgcaaactccaggacagagagcaaaaatccctggtgctggctagcccatgtgtgctgaag
gctctccacctcctctcacaggaaatgaaccgagaagtggtgttctgcatgagctttgtg
caaggagaggaaagagacaacaagattcctgtggccttgggtatcaaggacaagaatcta
tacctgtcttgtgtgaaaaaaggtgatacgcccaccctgcagctggaggaagtagacccc
aaagtctaccccaagaggaatatggaaaagcgctttgtcttctacaagacagaaatcaag
aatacagttgaatttgagtctgtcctgtaccctaactggtacatcagcacttctcaaatc
gaagaaaggcccgtcttcctgggacattttcgaggtggccaggatataactgacttcaga
atggaaaccctctctccctaa

DBGET integrated database retrieval system