KEGG   Bos indicus (zebu cattle): 109566330
Entry
109566330         CDS       T04792                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00230  Purine metabolism
biu01100  Metabolic pathways
biu01522  Endocrine resistance
biu04015  Rap1 signaling pathway
biu04020  Calcium signaling pathway
biu04022  cGMP-PKG signaling pathway
biu04024  cAMP signaling pathway
biu04062  Chemokine signaling pathway
biu04072  Phospholipase D signaling pathway
biu04114  Oocyte meiosis
biu04211  Longevity regulating pathway
biu04213  Longevity regulating pathway - multiple species
biu04261  Adrenergic signaling in cardiomyocytes
biu04270  Vascular smooth muscle contraction
biu04371  Apelin signaling pathway
biu04540  Gap junction
biu04611  Platelet activation
biu04713  Circadian entrainment
biu04714  Thermogenesis
biu04723  Retrograde endocannabinoid signaling
biu04724  Glutamatergic synapse
biu04725  Cholinergic synapse
biu04727  GABAergic synapse
biu04740  Olfactory transduction
biu04750  Inflammatory mediator regulation of TRP channels
biu04911  Insulin secretion
biu04912  GnRH signaling pathway
biu04913  Ovarian steroidogenesis
biu04914  Progesterone-mediated oocyte maturation
biu04915  Estrogen signaling pathway
biu04916  Melanogenesis
biu04918  Thyroid hormone synthesis
biu04921  Oxytocin signaling pathway
biu04923  Regulation of lipolysis in adipocytes
biu04925  Aldosterone synthesis and secretion
biu04926  Relaxin signaling pathway
biu04927  Cortisol synthesis and secretion
biu04928  Parathyroid hormone synthesis, secretion and action
biu04934  Cushing syndrome
biu04935  Growth hormone synthesis, secretion and action
biu04962  Vasopressin-regulated water reabsorption
biu04970  Salivary secretion
biu04971  Gastric acid secretion
biu04972  Pancreatic secretion
biu04976  Bile secretion
biu05032  Morphine addiction
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
biu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    109566330 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109566330 (ADCY3)
   04371 Apelin signaling pathway
    109566330 (ADCY3)
   04020 Calcium signaling pathway
    109566330 (ADCY3)
   04072 Phospholipase D signaling pathway
    109566330 (ADCY3)
   04024 cAMP signaling pathway
    109566330 (ADCY3)
   04022 cGMP-PKG signaling pathway
    109566330 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    109566330 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109566330 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109566330 (ADCY3)
   04062 Chemokine signaling pathway
    109566330 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    109566330 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    109566330 (ADCY3)
   04912 GnRH signaling pathway
    109566330 (ADCY3)
   04913 Ovarian steroidogenesis
    109566330 (ADCY3)
   04915 Estrogen signaling pathway
    109566330 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    109566330 (ADCY3)
   04921 Oxytocin signaling pathway
    109566330 (ADCY3)
   04926 Relaxin signaling pathway
    109566330 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    109566330 (ADCY3)
   04918 Thyroid hormone synthesis
    109566330 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    109566330 (ADCY3)
   04916 Melanogenesis
    109566330 (ADCY3)
   04925 Aldosterone synthesis and secretion
    109566330 (ADCY3)
   04927 Cortisol synthesis and secretion
    109566330 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109566330 (ADCY3)
   04270 Vascular smooth muscle contraction
    109566330 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    109566330 (ADCY3)
   04971 Gastric acid secretion
    109566330 (ADCY3)
   04972 Pancreatic secretion
    109566330 (ADCY3)
   04976 Bile secretion
    109566330 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109566330 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    109566330 (ADCY3)
   04727 GABAergic synapse
    109566330 (ADCY3)
   04725 Cholinergic synapse
    109566330 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    109566330 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    109566330 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    109566330 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    109566330 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    109566330 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109566330 (ADCY3)
   04714 Thermogenesis
    109566330 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566330 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    109566330 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109566330 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109566330 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566330 (ADCY3)
   05163 Human cytomegalovirus infection
    109566330 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109566330 (ADCY3)
Enzymes [BR:biu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     109566330 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N
Other DBs
NCBI-GeneID: 109566330
NCBI-ProteinID: XP_019826170
LinkDB
Position
11
AA seq 1145 aa
MPRTQGFSEPEYSAXXXAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLXRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSGDKLAPLAVAGVGLVLDII
LFVLCKKGLLPNRVTRRVVPYLLWLLISAQVFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQDGLKGVQLLREILANVFLYLCAIVVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGEGGSRCD
YLEEKGIETYLIIASKPEVKKTAAQNGLNGSALLNGAPPSSKPSSPALIETKESNGSIHT
SGSISEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTAVVEILIDPWLMTN
YVTFVVGEALLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPTNGTAEMQVEDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLIAGAVAVINIYAWCPIFDDYDRKRFQQHDFPMVALEKMQVFSSSGLNGTDRLPLVPSK
YSMTVMIFVMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEH
VARHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDF
DSLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKDEKSDKERWQHLADLADF
ALAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGV
MGNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGASITLPHQ
VVDNS
NT seq 3438 nt   +upstreamnt  +downstreamnt
atgccgaggacccagggcttctccgagccygagtactccgcggnnnnnncggccgagtac
tctgtcagcctgccttcggacccggaccgcggggtgggccggacccatgaaatctctgtc
cggaactcggggtcgtgcctctgcttgcstcgcttcatgcggctgaccttcgtaccagag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcggccctcttcgactgctatgtggtggtcatgtgcgctgtggtcttc
tctggcgacaagctggcccccctggccgtggctggggtcgggctggtgttggacatcatc
cttttcgtgctctgcaaaaaggggctgctccccaaccgggtcactcggagagtggtgccc
tacctgctgtggctgctgatatcagcccaggtcttctcctacctgggcctgaacttctcc
cgtgcccaygcggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcacgctgccgctcagcctcagccccattgtcatcatctccgtggtctcctgcgtcgtg
cacacactcgtcttgggggtcactgtggcccagcarcagcaggatgggctgaagggagtg
cagttgctgagggagattctggccaacgtcttcctctacctgtgcgccatcgtcgtgggc
atcatgtcctactacatggcagaccgcaagcaccgcaaggccttcctggaggcccgccag
tctctggaggtgaagatgaacctggaggagcagagtcagcagcaggagaaccttatgctc
tccatcctgcccaagcacgtggccgacgagatgctgaaggacatgaagaaggatgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgctgatatcgtgggcttcacccagctgtcctcagcctgcagcgcccaggagctt
gtgaagctgctcaatgagctctttgcccgcttcgacaagctggcggctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtgggctgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctcgccatggtggaggccatctcgtat
gtgcgggagaagacgaagaccggggtggacatgcgcgtgggggtgcacacgggcaccgtg
ctggggggcgtcctyggccagaaacgctggcagtacgacgtgtggtccaccgacgtcacc
gtggccaacaagatggaggctggcggcatccctgggcgtgtgcacatctcccagagcacc
atggactgcctgaaaggagagttcgacgtggagccgggcgaggggggcagtcgctgtgat
tacctggaagagaagggcattgagacctacctcatcatcgcttccaagccagaggtgaag
aagacagctgcccaaaatggcctcaacggctcggccctgctgaacggagcgccgccktcc
tcaaagcccagctcccctgccctcattgagaccaaggagtccaacgggagcattcacacc
agcggctctatatctgaggagccygaggagcaagatgcccaggccgacaacccctcgttc
cccaaccctcgccggaggctgcgccttcaggacctggctgatcgcgtggtggacgcctcc
gaggacgagcatgagctcaaccagctactcaacgaggcgctgctagagcgggagtctgcc
cargtagtgaagaagagaaacaccttcctcctgtccatgcggttcatggaccccgagatg
gaaacccgctactcggtggagaaggagaagcaragcggggctgccttcagctgctcctgc
gttgtcctactctgcacggccgtggtggagatcctcattgacccctggctcatgacgaac
tatgtgacctttgtggttggggaggctctgctcctgatcctgacaatctgctcgctggct
gccatctttccgcgggcctttcctaagaagctcgtggccttctctacttggattgaccgg
acgcgctgggccaggaacacctgggccatgctggccatcttcattcttgtcatggcaaac
gtggtggacatgctcagctgtctccagtactacacaggacccaccaacggcaccgcagag
atgcaggtggaggatggctgcgtggagaaccccaagtattacaactacgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctcacactcatg
ctgctcatcgcgggggccgtggctgtcatcaacatctacgcctggtgccccatctttgac
gactacgaccgcaaacgcttccagcaacacgactttccgatggtggccttagagaagatg
caggtgttttccagctcggggctcaatggcactgacaggctgcccctggtgccgtctaag
tactcgatgacagtgatgatctttgtcatgatgctgagcttttactacttctcccgccac
gtggaaaagctggcacggacactgttcttgtggaagattgaggtccacgaccagaaggaa
cgtgtctatgagatgcgacgctggaatgaagccttggtcaccaacatgctacctgaacac
gtggcacgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttat
gatgagattggagttatgtttgcctccctgcccaattttgctgacttctacacagaggag
agcatcaataacggtggcattgagtgtctacgcttcctcaatgagatcatctcagatttt
gactctcttctggacaatcccaagttccgggtcatcaccaagatcaagaccattggtagc
acctacatggcagcttcaggagtcaccccagatgtcaacaccaatggctttaccagctcc
aacaaggacgagaagtcagacaaggagcgctggcagcacctggcagatctggccgatttt
gcgctggccatgaaggacacgctcaccaacatcaacaaccagtccttcaacaacttcatg
ctgcgcattggaatgaacaaaggaggggtcctggctggggtcattggagcccggaaacca
cactatgacatctggggcaacacagtcaacgtagccagcaggatggagtccacaggggtc
atgggcaacatccaggtggtggaagaaacccaagtcatccttcgagaatacggcttccgc
ttcgtgaggagagggcccatctttgtgaaagggaagggggaactgctaacctttttcttg
aagggccgagacaagctggccacattccctaacggcgcctcaatcacactgcctcaccag
gtggtagacaactcctga

DBGET integrated database retrieval system