KEGG   Bos indicus (zebu cattle): 109566402
Entry
109566402         CDS       T04792                                 

Gene name
YWHAQ
Definition
(RefSeq) 14-3-3 protein theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109566402 (YWHAQ)
   04151 PI3K-Akt signaling pathway
    109566402 (YWHAQ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109566402 (YWHAQ)
   04114 Oocyte meiosis
    109566402 (YWHAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109566402 (YWHAQ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109566402 (YWHAQ)
   05160 Hepatitis C
    109566402 (YWHAQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109566402 (YWHAQ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109566402 (YWHAQ)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109566402 (YWHAQ)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109566402 (YWHAQ)
SSDB
Motif
Pfam: 14-3-3 SF3A2 FliM
Other DBs
NCBI-GeneID: 109566402
NCBI-ProteinID: XP_019826278
UniProt: A0A6P5CLB0
LinkDB
Position
11
AA seq 245 aa
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVXGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDXSKKEMQPTHPIXLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagaagacggagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaggccgtgacggagcagggcgccgagctgtccaacgaagag
cgcaacctgctgtcggtggcctacaagaacgtggtckggggccgccggtccgcctggagg
gtcatctccagcatcgagcagaagaccgacacctcggacaagaagttgcagctgatyaag
gactaccgggagaaagtrgagtccgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattacttccggtaccttgctgaagttgcttgtggtgatgatcggaagcaa
acgatagataattcccaaggagcttaccaagaggctttcgatrtaagcaagaaagagatg
caacccacacaccccatccrgctggggctggctcttaacttttctgtgttctactatgag
atcctcaataacccggaactggcctgcacactggctaaaacggcttttgatgaggctatt
gcagaactcgacacactgaatgaagactcgtacaaagacagcaccctcatcatgcagctg
ctgagagacaacctcacattatggacatcagacagtgcaggagaagaatgtgatgcggca
gaaggggcagaaaactaa

KEGG   Bos indicus (zebu cattle): 109567473
Entry
109567473         CDS       T04792                                 

Gene name
YWHAB
Definition
(RefSeq) 14-3-3 protein beta/alpha
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109567473 (YWHAB)
   04151 PI3K-Akt signaling pathway
    109567473 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109567473 (YWHAB)
   04114 Oocyte meiosis
    109567473 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109567473 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109567473 (YWHAB)
   05160 Hepatitis C
    109567473 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109567473 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109567473 (YWHAB)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109567473 (YWHAB)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109567473 (YWHAB)
SSDB
Motif
Pfam: 14-3-3 FliM SF3A2 Peptidase_C98
Other DBs
NCBI-GeneID: 109567473
NCBI-ProteinID: XP_019828008
UniProt: A0A6P5CR55
LinkDB
Position
13
AA seq 246 aa
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt   +upstreamnt  +downstreamnt
atgaccatggataaaagtgagctggtacagaaagccaagctcgccgagcaggccgagcgc
taygatgacatggctgcggccatgaaggcrgtcacagagcaggggcacgagctctccaac
gaggagagaaacctgctgtccgtcgcctacaagaatgtggtcggcgcccgccgttcgtcc
tggcgtgtcatctccagcatcgaacagaaaactgagaggaacgagaagaagcagcagatg
ggcaaagagtaccgcgagaagatcgaggccgagctgcaggacatctgcaatgacgtgctg
gagctgttggataaataccttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggcgattattttagatatctttctgaggtggcttctggagacaataaa
caaaccactgtgtcgaactcccagcaggcttaccaagaagcatttgaaattagtaagaaa
gaaatgcagcctacacaccccattcgactggggctggcacttaatttctccgtcttttat
tatgagattctaaactctcctgaaaaggcttgcagcctggcaaaaacggcgtttgatgag
gcgattgctgaattggacacactgaatgaagagtcttacaaagacagcaccctgattatg
cagctgcttagggacaatctcactctgtggacgtcggaaaaccagggagacgaaggagat
gctggggagggagagaactaa

KEGG   Bos indicus (zebu cattle): 109568481
Entry
109568481         CDS       T04792                                 

Gene name
YWHAZ
Definition
(RefSeq) 14-3-3 protein zeta/delta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109568481 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    109568481 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109568481 (YWHAZ)
   04114 Oocyte meiosis
    109568481 (YWHAZ)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109568481 (YWHAZ)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109568481 (YWHAZ)
   05160 Hepatitis C
    109568481 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109568481 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109568481 (YWHAZ)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109568481 (YWHAZ)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109568481 (YWHAZ)
SSDB
Motif
Pfam: 14-3-3 CSN7a_helixI FliM Peptidase_C98
Other DBs
NCBI-GeneID: 109568481
NCBI-ProteinID: XP_019829360
UniProt: A0A6P5CUI6
LinkDB
Position
14
AA seq 245 aa
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt   +upstreamnt  +downstreamnt
atggataaaaacgagctggtacagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctccagtattgagcaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaatagagaccgagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaacgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagactactaccgctacttggctgaggttgcagctggtgatgacaagaaaggg
attgtggatcagtcacagcaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactcccctgagaaagcctgctctcttgcaaagacagcatttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcagtta
ctgagagataacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

KEGG   Bos indicus (zebu cattle): 109570959
Entry
109570959         CDS       T04792                                 

Gene name
YWHAH
Definition
(RefSeq) 14-3-3 protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05160  Hepatitis C
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109570959 (YWHAH)
   04151 PI3K-Akt signaling pathway
    109570959 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109570959 (YWHAH)
   04114 Oocyte meiosis
    109570959 (YWHAH)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109570959 (YWHAH)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109570959 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109570959 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109570959 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109570959 (YWHAH)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109570959 (YWHAH)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109570959 (YWHAH)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109570959 (YWHAH)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 109570959
NCBI-ProteinID: XP_019832646
UniProt: A0A6P5D300
LinkDB
Position
17
AA seq 219 aa
MEVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYRE
KIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVV
EASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAE
LDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN
NT seq 660 nt   +upstreamnt  +downstreamnt
atggaagtgactgagctcaatgaacctctctccaacgaagaccgaaacctcctctccgtg
gcctacaagaacgtggttggtgcccggcggtcttcctggagggtcatcagcagcatcgag
cagaagaccatggctgatgggaatgagaagaagctggagaaggtgaaggcctaccgggag
aagattgagaaggagctggagacrgtgtgcaacgacgtgctggcgctgctggacaagttc
ctcatcaagaactgcaatgacttccagtacgagagcaaggtcttctacctgaagatgaag
ggcgactactaccgctacctggccgaggtggcttctggcgagaagaagaacagtgtggtg
gaggcctcagaggcggcctacaaggaagccttcgagatyagcaaggagcacatgcagccc
acacaccccatccggctgggcctggccctcaacttctccgtgttctactacgagatccag
aatgcgcctgagcaggcctgcctcctagccaaacaagccttcgacgacgccatagccgag
ctggacacactaaacgaggattcctataaggactccacgctcatcatgcagctgctgcga
gacaacctcaccctctggacgagcgaccagcaggacgaggaagccggagaaggcaactga

KEGG   Bos indicus (zebu cattle): 109573771
Entry
109573771         CDS       T04792                                 

Gene name
YWHAE
Definition
(RefSeq) 14-3-3 protein epsilon isoform X1
  KO
K06630  14-3-3 protein epsilon
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04722  Neurotrophin signaling pathway
biu05160  Hepatitis C
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109573771 (YWHAE)
   04151 PI3K-Akt signaling pathway
    109573771 (YWHAE)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109573771 (YWHAE)
   04114 Oocyte meiosis
    109573771 (YWHAE)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109573771 (YWHAE)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109573771 (YWHAE)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109573771 (YWHAE)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109573771 (YWHAE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109573771 (YWHAE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109573771 (YWHAE)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109573771 (YWHAE)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109573771 (YWHAE)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5 Ta0938
Other DBs
NCBI-GeneID: 109573771
NCBI-ProteinID: XP_019836749
UniProt: A0A6P5DGG5
LinkDB
Position
19
AA seq 255 aa
MDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASW
RIISSIEQKEENKGGEDKLKMIREYRQMVETELKLICCDILDVLDKHLIPAANTGESKVF
YYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIAMTELPPTHPIRLGLALNFSVF
YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE
EQNKEALQDVEDENQ
NT seq 768 nt   +upstreamnt  +downstreamnt
atggatgatcgggaggatctggtgtaccaggcgaagctggccgagcaggctgagcgatac
gacgaaatggtggagtcaatgaagaaagtagcagggatggatgtggagttgacagttgaa
gaaagaaacctcctatctgttgcatataaaaatgtgattggagctagaagagcttcctgg
agaataatcagcagcattgaacagaaagaagaaaacaagggaggagaagacaaactaaaa
atgattcgggaatatcggcaaatggttgagactgagctaaagttaatctgttgtgacatt
ctggatgtactggacaaacacctcattccagcagctaacactggcgagtccaaggttttc
tattataaaatgaaaggggactaccacaggtatctggctgaatttgccacagggaatgac
aggaaggaggctgcggagaacagcctagtggcttataaagctgctagtgatattgcaatg
acagaacttccaccaacacatcccattcgcttaggtcttgctctcaacttttctgtattc
tactatgaaattcttaattcccctgaccgtgcctgcaggttggcaaaagcagcttttgat
gatgcaattgcagaactggacacgctgagtgaagaaagctataaggactctacacttatc
atgcagttgttacgtgataatctgacactatggacttcagacatgcagggtgatggtgaa
gagcagaataaagaagcgctgcaggatgtggaagatgaaaatcagtga

KEGG   Bos indicus (zebu cattle): 109578441
Entry
109578441         CDS       T04792                                 

Gene name
YWHAG
Definition
(RefSeq) 14-3-3 protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04110  Cell cycle
biu04114  Oocyte meiosis
biu04151  PI3K-Akt signaling pathway
biu04390  Hippo signaling pathway
biu05160  Hepatitis C
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109578441 (YWHAG)
   04151 PI3K-Akt signaling pathway
    109578441 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109578441 (YWHAG)
   04114 Oocyte meiosis
    109578441 (YWHAG)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109578441 (YWHAG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    109578441 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109578441 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:biu03400]
    109578441 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109578441 (YWHAG)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109578441 (YWHAG)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    109578441 (YWHAG)
Exosome [BR:biu04147]
 Exosomal proteins
  Proteins found in most exosomes
   109578441 (YWHAG)
SSDB
Motif
Pfam: 14-3-3
Other DBs
NCBI-GeneID: 109578441
NCBI-ProteinID: XP_019843207
UniProt: A0A6P5E1Z9
LinkDB
Position
25
AA seq 167 aa
MVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESKVFYLKMKGDYYRYLAEVATG
EKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYSVFYYEIQNAPEQACHLAKTA
FDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDDGGEGNN
NT seq 504 nt   +upstreamnt  +downstreamnt
atggtccgtgcttaccgtgaaaaaatagagaaggagttggaggccgtatgtcaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtatgagagcaaa
gtgttttacctgaagatgaaaggggactattaccgctacctggccgaagtcgccaccggc
gagaagagggcgaccgtcgtggagtcatctgagaaggcctacagcgaagcccacgagatc
agcaaggagcacatgcagcccactcaccccattagattaggcctggcccttaactactcc
gtcttctactacgagatccagaacgccccggagcaagcctgccacttggccaagaccgcc
ttcgacgatgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacg
ctgatcatgcagctgctccgtgacaacctcacgctctggacgagcgaccagcaagacgac
gacggcggcgaaggcaacaattaa

DBGET integrated database retrieval system