KEGG   Bos indicus (zebu cattle): 109566554
Entry
109566554         CDS       T04792                                 

Gene name
ABL1
Definition
(RefSeq) tyrosine-protein kinase ABL1
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04014  Ras signaling pathway
biu04110  Cell cycle
biu04360  Axon guidance
biu04722  Neurotrophin signaling pathway
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05220  Chronic myeloid leukemia
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109566554 (ABL1)
   04014 Ras signaling pathway
    109566554 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109566554 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109566554 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    109566554 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566554 (ABL1)
   05206 MicroRNAs in cancer
    109566554 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109566554 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109566554 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109566554 (ABL1)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109566554 (ABL1)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  ABL family
   109566554 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 SH3_6
Other DBs
NCBI-GeneID: 109566554
NCBI-ProteinID: XP_019826588
UniProt: A0A6P5CM58
LinkDB
Position
11
AA seq 1151 aa
MGQQPGKVLGDQRRPSLPALHFIKGAGKKEPSRHGGPHCNVFVEHEALQRPVASDFEPQG
LSEAARWNSKENLLAGPSENDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCE
AQTKNGQGWVPSNYITPVNSLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQR
SISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRN
KPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVE
EFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTYGNLLDYLRDCNRQEVNAVVLL
YMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKF
PIKWTAPESLAYNKFSIKSDIWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERP
EGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQESSISDEVEKELGKKGMRGVAGT
LLQAPELPTKTRTSRRAAEHKDSPDMPETPHSKGPGETDPVDHEPAVSPLLPRKERGPPD
GSLNEDERLLPKDKKTNLFSALIKKKKKTAPTPPKRSSSFREMDGPPERKAASEEEGREI
SNGALAPAPPDAVESAKSLKPSGGAGVPNGAFRESGGAGFRSPHLWKKSSTLTSSRLAAG
EEESGSGASKRFLRSCSASCVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPA
LPRKRASENRSDQMTRGTVTPPPRLVKKTEEAADEVFKDAAEASPGSSPPSLTPKPIRRQ
GAXXPPSSPPHKEEAGRPSAAEMPAEPAPPTSRAGLGASGGPSKAAATAAEEPRGRRHKP
TSESPGRDRGKLSKLKPAPPPPPPTSAGKAGKSSQSPSQEAAGEAGAGAKVKPAALAADA
VNSDTAKSGQLGEGAKKPVLPSMPKPPASTKPAGTPTSPAPTPATLPSAPSALAGDQPSS
TAFIPLISTRVSLRKTRQPPERIASGAITKGMVLDGTEALCLAISKNSEQMASHSAVLEA
GKNLYTFCVSYVDSIQQMRNKFAFREAINKLENNLRELQICPATAGGGPAATQDFSKLLS
SVKEISDIVQR
NT seq 3456 nt   +upstreamnt  +downstreamnt
atggggcagcagcctggaaaagttcttggggaccaaaggaggccaagtctgcctgccctg
cactttatcaaaggagcaggcaagaaggagccatcaaggcacgggggtccacactgcaat
gtttttgtggaacacgaagcccttcagaggccagtagcatctgacttcgagccccaaggt
ctgagcgaagcagctcgttggaactctaaggaaaaccttcttgctggtcccagtgaaaat
gaccccaacctttttgttgcactgtatgactttgtggccagtggggataacactttaagc
ataactaaaggtgaaaagctccgggtcttaggctacaatcacaatggggagtggtgtgaa
gcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacaccggtcaacagc
ctggagaagcactcctggtaccacgggcctgtgtcccgcaacgccgccgagtaccttctg
agcagtgggatcaacggcagcttcttggttcgggagagcgagagtagtcctgggcagagg
tccatctcactgagatacgaaggaagggtgtaccactaccgcatcaacactgcttctgat
ggcaagctctacgtctcctccgagagccgcttcaacacgttggccgagctggtccatcac
cactccactgtggccgacgggctcatcaccactctccactacccggcccccaagcgcaac
aagcccaccgtctacggcgtgtcccccaactacgacaagtgggagatggagcgcacggac
atcaccatgaagcacaagctggggggcggccagtacggggaggtgtacgaaggcgtgtgg
aagaaatacagcctgacggtggccgtgaagaccctgaaggaggataccatggaggtggag
gagttcttgaaagaggctgcagtaatgaaagagatcaagcaccccaacttagtacagtta
ctcggggtctgcacccgggagcccccattctacataatcactgagttcatgacctatggg
aacctgctggactacctgagggactgtaaccggcaggaggtgaacgccgtggtgctgctg
tatatggccacgcagatctcgtccgccatggagtacctggagaagaaaaacttcatccac
agagatcttgctgcccgaaactgcctggtaggggaaaaccacttggtgaaggtggctgat
tttggcctgagcaggctgatgacaggggacacctacacagcccacgccggggccaagttc
cccatcaagtggacggcgcccgagagcctggcctacaacaagttctccatcaagtcagac
atctgggcatttggagtgttgctttgggaaattgctacctatggcatgtcaccttaccca
ggaattgacctgtcccaggtgtatgagctgttggagaaagactaccgcatggagcgcccg
gaaggctgcccagagaaggtctacgaactcatgcgagcatgttggcagtggaatccctct
gaccggccctccttcgctgagatccaccaagcctttgaaacgatgttccaggaatccagc
atatcagacgaagtggaaaaggagttggggaagaaaggcatgcgaggggttgcaggtacc
ctgctgcaggccccagaactgcccaccaagacgagaacctccaggagagctgctgagcac
aaagacagccccgacatgcccgagacaccccactccaagggcccaggagagactgatcct
gtggaccacgaacccgctgtatctccactgctccctcgaaaagaacggggtcctccggat
ggcagcctcaatgaggatgagcgcctgcttcccaaagacaagaagaccaacctgttcagc
gccttgatcaagaagaagaagaaaaccgccccaacccctcccaaacgcagcagctccttc
cgggagatggatggcccgcctgagcggaaagcggccagcgaggaggaaggtcgtgaaatc
agcaacggggcgctggcaccggcacccccggatgcagtggagtcggccaagtccctaaag
cccagcggcggggccggggtccccaacggagccttccgggagtctgggggcgcgggcttc
cggtcgccccacctgtggaaaaagtccagcactctgaccagcagccggctggctgccggt
gaagaggagagcggcagcggcgccagcaagcgcttcctgaggtcctgctcggcctcctgc
gtgccccacggcgccaaggacacagagtggcggtcagtcaccctgcctcgggacctgcag
tccaccggcaggcagttcgactcgtccacctttggaggccacaaaagcgagaagccggcc
ctgcctcgaaaacgggcaagcgagaacaggtctgaccagatgaccagaggcacggttacc
ccgccgccccggctggtgaagaaaaccgaggaggccgccgacgaggtctttaaggatgcg
gctgaggccagcccaggctccagcccacccagcctgacgccaaaaccaattcggaggcag
ggtgcggnnnnacctccctccagccctccccacaaggaggaggccggcaggcccagtgcc
gcggaaatgcccgctgagccggcaccccccaccagccgggccgggctaggagcctccgga
ggacccagcaaggctgccgccactgctgcagaggagccccgggggaggaggcacaagccc
acctctgagtccccagggagagacagggggaagctgtccaagctcaaacccgccccgcca
cccccaccacccacctccgctggcaaagccgggaagtcctcgcagagcccgagccaggaa
gcagccggggaggcaggcgccggggcaaaggtgaaacctgcagctctggctgcggatgcc
gtaaacagcgacaccgccaagtctggccagctgggagagggcgccaagaagcccgtgctc
ccatccatgccaaagccgccggcatccaccaagccggcggggaccccgaccagccccgcc
cccacccccgccaccttgccgtcagcaccctctgccctggcaggggaccagccgtcctcc
accgccttcattccactcatatcgacccgcgtgtctcttcggaaaacccggcagcctcct
gaacggatcgccagtggcgccatcaccaagggcatggtgctggatggcacggaggccctg
tgcctggccatctccaagaactcagagcagatggccagccacagcgccgtgctcgaagcc
ggcaaaaacctctacacattctgcgtgagctacgtggactccatccagcaaatgaggaac
aaattcgccttccgcgaggccatcaacaaactggagaacaacctccgggagctgcagatc
tgcccagcaacagcaggtggtggcccagcggccactcaggacttcagcaaactcctcagc
tccgtgaaggagatcagcgacatcgtgcagaggtag

KEGG   Bos indicus (zebu cattle): 109571416
Entry
109571416         CDS       T04792                                 

Gene name
BCR
Definition
(RefSeq) breakpoint cluster region protein
  KO
K08878  breakpoint cluster region protein [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05200  Pathways in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109571416 (BCR)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109571416 (BCR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109571416 (BCR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109571416 (BCR)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109571416 (BCR)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: Other
  BCR family
   109571416 (BCR)
Membrane trafficking [BR:biu04131]
 Others
  Rho GTPase associated proteins
   Rho GTPase-activating proteins
    109571416 (BCR)
SSDB
Motif
Pfam: RhoGAP RhoGEF PH_19 C2 PH IQ_SEC7_PH PH_5 HBM SKA1
Other DBs
NCBI-GeneID: 109571416
NCBI-ProteinID: XP_019833436
UniProt: A0A6P5D584
LinkDB
Position
17
AA seq 849 aa
MAQPGSPLDALFGTPPGFGCASDRAEEPRXPQDGLPYIDDSPASSPHLSSKARGGRDPAE
PSRASELDLEKGSEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQI
ETIFFKVPELYEIHKDFYDGLLPRVQQWSRQQRVGDLFQKLASQLGVYRAFVDNYEVAME
TAEKCCQANAQFAEISENLRARSNKEAKDQTTKNSLETLLYKPVDRVTRSTLVLHDLLKH
TPPSHPDHPLLQDALRISQNFLSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGAR
KLRHVFLFTDLLLCTKLKKQSGGKAQQYDCKWYIPLTDLSFQTVDESEAAPSIPLVLDEE
LDAMKVKISQIKSDIQREKRANKGSKAIERLRKKLSEQESLLLLMSPNMAFRVHSRNGKS
YTFLISSDYERAEWRENIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHSIPLTINKED
DESPGLYGFLNVIVHSASGFKQSSSLYCTLEVDSFGYFVNKAKTRVXRDTAEPNWNEEFE
IELEGSQTLRILCYEKCYHKTRLAKEDGGESTDRIVGKGQAQLDPQTLQDRDWQRTAIAM
NGIEVKLSIKFTSRELSLKRMPSRKQTGVFGVRIAVVTKRERSKVPYIVRQCVEEIERRG
MEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTD
EFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLEHLKRVAEKETVNKMSLHN
LATVFGPTLLRPSEKENKPPANPSQAISMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSRR
QSVLFSTEV
NT seq 2550 nt   +upstreamnt  +downstreamnt
atggcccagccagggagtcckcttgatgcgttgttcgggacgccaccggggttcggctgt
gcctcggatcgggcggaggagccgcgcckgccccaggacgggctgccctacatcgacgac
tcgcccgcctcctcaccccacctcagcagcaaggcccggggtggcagggacccggcggag
cccagcagagcgagtgagctggacttggaaaagggctcagagatgagaaaatgggtcctg
tctggcatcctggctagcgaggagacttacctgagccatctggaggcgctgctgctgccc
atgaagcctctgaaggcggctgccaccacctctcagcccgtgctgacgagccagcagatc
gagaccatcttcttcaaagtgcctgagctctacgagatccacaaggacttctacgacggg
ctcctgccccgcgtgcagcagtggagccgccagcagcgcgtgggcgacctcttccagaag
ctggccagccagctgggtgtgtaccgggcctttgtggacaactatgaagttgccatggaa
acagccgagaagtgctgtcaagccaatgctcagtttgcagaaatctctgagaacctgcga
gccaggagcaacaaggaggccaaggaccagacgaccaagaactctctggaaaccctgctg
tacaagcccgtggaccgggtgacccggagcacgctggtcctgcacgacttgctgaaacac
acgccccccagccaccctgaccacccgctgctgcaggacgccctccgcatctcgcagaac
ttcctgtccagcatcaacgaggagatcacgccccgccggcagtccatgaccgtgaagaag
ggagagcaccggcagctgctcaaggacagcttcatggtggagctggtggagggggcccgc
aagctgcggcacgtcttcctcttcacagacctgctgctctgcaccaagctcaagaagcag
agcgggggcaaagcccagcagtacgactgcaagtggtacatcccgctcacggacctcagc
ttccagacggtggacgagtcggaggctgcacccagcatccctctggtgctggacgaggag
ctggatgccatgaaggtcaagatctcccagatcaagagtgacatccagagagagaagaga
gcgaacaagggcagcaaggccatcgagaggctgaggaagaagctctcggagcaggagtcg
ctgctgctcctcatgtccccgaatatggccttccgcgtgcacagccgcaacgggaagagt
tacacgttcctcatctcctccgactacgagcgggccgagtggagagagaacatccgggag
cagcagaagaaatgtttcaagagcttctcgctgacgtccgtggagctgcagatgctgacg
aactcgtgtgtcaaactgcagaccgtccacagcatcccactgaccatcaacaaggaagat
gacgaatctcctgggctctacgggttcctgaatgtcatcgtccactctgccagcggcttt
aagcagagttcaagtctgtactgcaccctggaggtggattccttcggctactttgtaaat
aaagccaagacgcgcgtnnncagggatacagccgagcccaattggaacgaggagtttgag
atcgagctggaaggctcgcagaccctgaggatcctgtgttacgagaagtgttaccacaag
accaggctcgccaaggaggacggtggggagagcacggaccggatcgtgggcaagggccag
gcacagctggaccctcagaccctgcaggacagagactggcagcggaccgccatcgccatg
aacgggatcgaagtgaagctgtcaatcaagttcaccagcagggaactcagcttgaagagg
atgccttcccgaaaacagacaggcgtyttcggagtcaggatcgccgtggtcaccaagagg
gagcggtccaaggtaccctacatcgtgcgccagtgtgtcgaggagatcgagcgccggggc
atggaggaggtgggcatctaccgcgtgtccggagtggccacggacatccaggccctgaag
gcggcctttgacgtcaacaacaaggacgtgtcggtgatgatgagcgagatggacgtgaac
gccatcgccgggacgctcaagctctacttccgcgagctgcccgagcccctcttcaccgac
gagttctaccccaacttcgccgagggcatcgcgctctcggaccccgtggcgaaggagagc
tgcatgcttaacctgctgctgtcactgccggaagccaatctgctcaccttcctcttcctc
ctggaacacctgaaaagggtggcggaaaaggagacggtgaataagatgtccctgcacaac
ctcgccacggtgttcggccccacgctgctccggccctcggagaaggagaacaagccgccc
gccaaccccagccaggccatctccatgaccgacagctggtccctggaggtcatgtcccag
gtccaggtgctgctgtacttcctgcagctggaggccatccccgccccggacagcaggagg
cagagcgtcctcttctccaccgaagtctag

DBGET integrated database retrieval system