KEGG   Bos indicus (zebu cattle): 109566571
Entry
109566571         CDS       T04792                                 

Gene name
TSC1
Definition
(RefSeq) hamartin isoform X1
  KO
K07206  tuberous sclerosis 1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04072  Phospholipase D signaling pathway
biu04140  Autophagy - animal
biu04150  mTOR signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04152  AMPK signaling pathway
biu04211  Longevity regulating pathway
biu04218  Cellular senescence
biu04714  Thermogenesis
biu04910  Insulin signaling pathway
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05168  Herpes simplex virus 1 infection
biu05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    109566571 (TSC1)
   04151 PI3K-Akt signaling pathway
    109566571 (TSC1)
   04152 AMPK signaling pathway
    109566571 (TSC1)
   04150 mTOR signaling pathway
    109566571 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    109566571 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    109566571 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109566571 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    109566571 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    109566571 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109566571 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109566571 (TSC1)
   05163 Human cytomegalovirus infection
    109566571 (TSC1)
   05165 Human papillomavirus infection
    109566571 (TSC1)
SSDB
Motif
Pfam: Hamartin ATG16
Other DBs
NCBI-GeneID: 109566571
NCBI-ProteinID: XP_019826621
UniProt: A0A6P5CMC0
LinkDB
Position
11
AA seq 1159 aa
MAQQANIGELLSMLDSPLLSVRDDVTTVFKENLNSDRGPMLVNTLVDYYLETNSQPVLHI
LTTLQEPHDKHLLDKMNEYVGKAASRLSALLLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVIVLTTGVLVLITMLPMIPQSGKQHLHDFFDIFGRLSSWCLKKPGHVTEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVSASSYVDT
QNSYGNATSTPYSTSRLXLNTPGQLPQTLSSPSTRLLAEPPQATLWSPSAVCGMTTPPTS
PGNVPPDLSHPYSKVFGTTGGKGTPLGTPATSPPPAPPCHSDDCVHLSLPQATAPKKEER
TDSARPCLHRQPHVPNDRGLEELHGGKGSVTLSDLPGFLGDLASEEDSIEKDKEEAAISK
ELSEITTADAEPLVPRGGFDSPFYRDSLPGCPRKTLSASSSTQGTSANPEPLNSSLDKSG
PDTPKQAFTPIDLPCGGTGESPAGNRERQASLEASILTPSPCKIPPQRGVGFGSGQPPPY
DHLFEVALPKTAHHFVSKKTEELLKKAKGSAEEDFTPSASPMEVLDRLIQQGADVHSKEL
NRLSLPSKSVDWTHFGGSPPSDEIRTLRNQLLLLHNQLLYERFKRQQHALRNRRLLRKVI
RASALEEHNAAMKDQLKLQEKDIQIWKISLQKEQARYNQLQEQRDTVVTQLHSQIRQLQH
DREEFYNQSQELQTKLEDCRNMIAELRVELKKASSKVCHTELLLSQVSQKLSNSESVQQQ
MEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKAAYRKELEKNRSHVLQQNQRLDT
CQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFELEILD
LYGKLEKDGLLKKLEEQKPEAAEAAEERLDYCQDGCSDSVTGHNEEAPGRNGETKPSRPG
GARGGGGGGGRGGGSSSELSTPEKPPNPRAGPFSSRWETVVGEPTSGTPTTVGSLPSSES
FLGMKARELFRNKSESQCDEDGLTVGSLSETLKTELGKDSGVEARAPLTLDGPLLPAPKP
DSVGQLRIMDYNEAQLEHS
NT seq 3480 nt   +upstreamnt  +downstreamnt
atggcccagcaagccaatattggggagctcctctccatgctggactcccctctgctgagt
gtgcgtgatgatgtaacaactgtctttaaagagaatctcaattctgaccgtggtcctatg
cttgtgaacaccctggtggattattatctggaaaccaactctcagcctgtattgcacatc
ctgactaccttgcaagagccccatgataagcacctcttggacaaaatgaatgaatacgtg
ggcaaggccgcctctcggttatccgccctcttgctactgggccacgtcgtgaggctgcag
ccgtcatggaagcataagctctctcaagcacctcttttgccttctctactaaaatgtctc
aagatggacaccgacgtcattgtcctcacaacaggagtcttagtgttgataaccatgctc
ccaatgattccgcagtcggggaaacagcaccttcatgatttctttgatatctttggccgt
ctttcgtcatggtgcctgaagaaaccaggccatgtgacagaagtctatctcgtccacctc
cacgccagcgtctacgctctcttccatcgcctgtatgggatgtacccttgcaactttgtc
tcctttctgcgttctcactacagtatgaaggaaaacctggagacttttgaagaagtggtc
aagccaatgatggagcaygtgcgaattcacccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaacacatgatgttgtcatagaatgtgcc
aaaatctctctggaccctacagaggcctcatatgaagatggctattctgtgtctcaccaa
atctcagcccgttttcctcaccgttcagccgatgtctccgccagctcttacgttgacaca
cagaatagctatgggaatgctacttctaccccctactctacttctcggctgaygttaaac
acgccagggcagctacctcagactctgagttccccgtcgacacggctattagctgagccg
ccacaagctactctttggagcccatctgcagtttgtgggatgaccactcctccaacttct
cctggaaatgtcccacctgatctgtcacatccttacagtaaagtctttggtacaactggt
gggaaaggaactcctctgggaacccctgcaacctctcctcctccagccccaccctgccat
tcggacgactgcgtgcacctttcactcccacaggccacggcccccaagaaggaagagagg
acagactccgcaaggccctgtctacacagacaaccccatgttccgaatgacagaggatta
gaagagctgcacggaggcaagggatctgtcactctcagtgatcttccagggtttttagga
gacctggcttctgaagaagacagtattgagaaggataaagaagaagcggccatatctaaa
gagctgtctgagatcacgacggccgatgccgagcccctggttcctcgaggaggcttcgac
tcacccttctaccgggacagtctgccgggctgcccgcggaagaccctctcagcttcctcc
agcactcagggcaccagcgcgaaccctgagcctttaaactcctccctggacaagtcgggg
cctgacacaccaaagcaagccttcacgcccatagacctgccctgcggaggcaccggggag
agccctgccgggaacagggagcgccaggcctctctggaggccagcatcctcacccccagc
ccctgtaaaattccacctcagaggggagtggggtttggcagtgggcagcctcccccatac
gatcatctttttgaggtggcattgccaaagactgcccatcattttgtcagcaagaagacg
gaggaactgctcaagaaggcaaagggaagtgcagaggaggacttcacgccctccgcctcc
cctatggaagtgctggacaggctgatacagcagggagcggacgtgcacagcaaggagctc
aacaggttgtctttacccagcaagtctgtcgactggacccacttcggaggctctcctccc
tcagatgagatccgcaccctccgtaaccagttgcttttactgcacaaccagttactctac
gagcgtttcaagcggcagcagcacgcgctgcgcaacaggcggctcctgcgcaaggtgatc
cgggcctcggctctggaggagcacaacgccgccatgaaagaccagttgaagttgcaagag
aaagacatccagatatggaagattagtctgcagaaagaacaagccaggtacaatcagctt
caggagcagcgagacacagtggtcacccagcttcatagccagatcagacagcttcagcac
gaccgggaggagttctacaaccagagccaggagttacagacgaagctggaggactgcagg
aacatgatcgcagagctgcgcgtggagctgaagaaggccagcagcaaggtgtgccacacc
gagctgctgctcagccaggtgtcccagaagctctcaaatagtgagtcggtccaacagcag
atggagttcttgaacaggcaactgttggttcttggggaagtcaacgagctgtatttggaa
cagctgcagaacaagcattcagacaccaccaaggaagtagaaatgatgaaggctgcatat
cggaaagagctagaaaaaaacagaagccacgtcctccagcagaatcagaggcttgatacc
tgtcagaagcggattttggaactggaatctcatctggctaagaaagaccaccttctttta
gaacagaaaaagtatctagaggatgtcaaactgcaggcaagaggacagctacaggctgca
gagagcaggtatgaggcccaaaagaggatcacccaggtgtttgaattggagatcttagat
ttatacggcaagttggagaaggatggcctcctgaaaaaacttgaagaacaaaaaccagaa
gcagctgaagcagcagaagaaaggcttgactactgtcaggacggctgctcggattcggtg
acagggcacaacgaagaggcccctggccgtaacggtgagaccaagccctccaggcctggc
ggtgcccggggcggtggcggtggcggcggcagaggtggcggcagcagcagcgagctctcc
accccggagaagccccccaaccccagggcgggcccgttcagcagtcggtgggagacggtg
gtgggtgagcccacttccggcacccccacgacggtgggctcgcttcccagctcagagagc
ttcctgggcatgaaggcacgagagctgtttcgtaacaagagcgagagccaatgcgacgag
gatggcctgactgttggcagcctttctgagaccctaaagacagagctgggcaaagactcg
ggtgtggaagccagggcccccctgacccttgatggcccactgctgcctgccccaaagccg
gacagcgtgggccagctccgcatcatggactacaacgaggcccagcttgagcacagctag

DBGET integrated database retrieval system