KEGG   Bos indicus (zebu cattle): 109566677
Entry
109566677         CDS       T04792                                 

Gene name
TNFSF11
Definition
(RefSeq) tumor necrosis factor ligand superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04064  NF-kappa B signaling pathway
biu04380  Osteoclast differentiation
biu04917  Prolactin signaling pathway
biu04928  Parathyroid hormone synthesis, secretion and action
biu05224  Breast cancer
biu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    109566677 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109566677 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    109566677 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    109566677 (TNFSF11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    109566677 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    109566677 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    109566677 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109566677 (TNFSF11)
   04090 CD molecules [BR:biu04090]
    109566677 (TNFSF11)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Tumor necrosis fators
   109566677 (TNFSF11)
CD molecules [BR:biu04090]
 Proteins
  109566677 (TNFSF11)
SSDB
Motif
Pfam: TNF DisA DUF2735
Other DBs
NCBI-GeneID: 109566677
NCBI-ProteinID: XP_019826773
UniProt: A0A6P5CMS9
LinkDB
Position
12
AA seq 244 aa
MDPNRISEDDTHCINRIFKLHENTDLQDTTLESQDSKLIPDSCKRIKQAFQAAVQKEMQH
IVKSQHIRAEKAMVEGSWLDLARRNKPEIQPFAHLTINATDIPSGSHKVTLSCWYHDRGW
AKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGNLSANYLQLMVYVTKTSIKIPSSH
TLMKGGSTKYWLGNSEFHFYSINVGGFFKLRSGEKISIEVSNPSLLDPDQDATYFGAFKV
RDID
NT seq 735 nt   +upstreamnt  +downstreamnt
atggatcctaacagaatatcagaagatgacactcactgcattaatagaattttcaagctc
catgaaaacacagatttgcaagacacaactctggagagtcaagactcaaaattaatacct
gattcgtgtaagagaattaaacaggcttttcaagcagctgtgcagaaggaaatgcaacat
attgttaaatcacagcacattagagcagaaaaagccatggtggaaggttcatggttagat
ctggccagaaggaacaaacctgagattcagccctttgcccatctcacgattaacgccact
gacatcccatcaggttcccacaaagtgactctgtcctgctggtaccatgaccgaggttgg
gccaagatctccaacatgaccttcagcaatgggaaactgatagttaaccaagacggcttc
tattacctgtacgccaacatctgctttcgacatcatgagacttcgggaaacctcagtgcg
aattatcttcagctgatggtatatgtcaccaaaaccagcatcaaaatccccagttctcac
actctgatgaaaggaggaagcaccaagtactggttggggaattctgaattccatttttac
tccataaacgtgggaggattttttaagctacggtctggcgagaaaataagcattgaggtc
tccaacccttcactactggatccagatcaagatgcaacatactttggggcttttaaagtt
cgagatatagattga

DBGET integrated database retrieval system