KEGG   Bos indicus (zebu cattle): 109566987
Entry
109566987         CDS       T04792                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein
  KO
K06618  retinoblastoma-associated protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04110  Cell cycle
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109566987 (RB1)
   04218 Cellular senescence
    109566987 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109566987 (RB1)
   05203 Viral carcinogenesis
    109566987 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109566987 (RB1)
   05225 Hepatocellular carcinoma
    109566987 (RB1)
   05226 Gastric cancer
    109566987 (RB1)
   05214 Glioma
    109566987 (RB1)
   05220 Chronic myeloid leukemia
    109566987 (RB1)
   05218 Melanoma
    109566987 (RB1)
   05219 Bladder cancer
    109566987 (RB1)
   05215 Prostate cancer
    109566987 (RB1)
   05224 Breast cancer
    109566987 (RB1)
   05222 Small cell lung cancer
    109566987 (RB1)
   05223 Non-small cell lung cancer
    109566987 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109566987 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109566987 (RB1)
   05161 Hepatitis B
    109566987 (RB1)
   05160 Hepatitis C
    109566987 (RB1)
   05163 Human cytomegalovirus infection
    109566987 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109566987 (RB1)
   05169 Epstein-Barr virus infection
    109566987 (RB1)
   05165 Human papillomavirus infection
    109566987 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109566987 (RB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109566987 (RB1)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109566987 (RB1)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109566987 (RB1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    109566987 (RB1)
SSDB
Motif
Pfam: Rb_C RB_A RB_B DUF3452 RuvC_1 TFIIB
Other DBs
NCBI-GeneID: 109566987
NCBI-ProteinID: XP_019827285
UniProt: A0A6P5CNN2
LinkDB
Position
12
AA seq 946 aa
MPPKTPRRAAAAAAAAAAEPPPPTKRVFLCSRGIIFLLGKRTYLIGRCGDSIYLHLRYIF
SFGRLEFEETEEPDFTALCQKLKLPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELWGIC
IFIAAVDLDEMPFTFTELQKNIETSVYKFFDLLKEIDTSTKVDNAMSRLLKKYNVLCALY
SKLERTCELIYLTQPSSSISTEINSMLVLKVSWITFLLAKGQVLQMEDDLVISFQLMLCV
LDYFIKLSPPALLKDPYKTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHE
CNIDEVKNVYFKNFIPFMNSLGIVASNGLPEVENLSKQYEEIYLKNKDLDARLFLDHDKT
LQADPTDSFEMQRTPRKSNPDEEVNMILPQTPVRTVMNTIQQLMMILNSASDQPSENLIS
YFNNCTVNPKDSILKRVKDIGDVFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLK
SEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSMSQSLDTGTDLSFPWILNVFN
LKAFDFYKVIESFIKAEANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGP
VDHFEPACTLNLPLQNNHTAADMYLSPVRSPKKKGPTPRVNSTPNSEAQATSAFQTQKPL
KSTSLSLFYKKVYRLAYLRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQ
IMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQ
RLKTNILQYASTRPPTLSPIPHIPRSPYKFSSSPLRIPGGNIYISPLNNPYKISEGLPTP
TKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGS
DEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNESVDTSNREEK
NT seq 2841 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccggagagcagcagcagccgccgccgccgccgccgcggaaccc
ccgccgcctacaaaacgagtgtttttgtgctcacgtggaattatttttcttctcggtaag
aggacttatctaataggccgatgtggggattcaatctaccttcatctaagatatattttt
tcatttggtaggcttgagtttgaagaaactgaagaacctgattttactgcattatgtcag
aaattaaagctaccagatcatgtcagagaaagagcttggttaacttgggaaaaagtttca
tctgtggatggagtattggaaggttatgttcaaaagaaaaaggaactgtggggaatctgt
atttttatcgcagcagttgacttagatgagatgccgttcactttcactgagctacagaaa
aacattgaaaccagtgtctataaattctttgatttactaaaagaaatcgataccagtacc
aaagttgataatgctatgtcaagactgttgaagaagtataatgtgttgtgtgcactctac
agcaaattagaaaggacatgtgagcttatatatttgacacaacccagcagttcgatatct
actgaaataaattctatgttggtgctaaaagtttcttggatcacatttttattagctaaa
ggacaagtattacaaatggaagatgatctggtgatctcatttcaattaatgctgtgtgtc
cttgactattttatcaaactctcacctcctgcattgctcaaagacccatacaaaacagct
gtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacaggagtgcacgg
atagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaagaacatgaa
tgtaatatagatgaggtgaaaaatgtttatttcaaaaattttataccttttatgaattct
cttggaattgtagcttctaatggacttccagaggtggaaaatctctctaaacaatatgaa
gaaatttaccttaaaaacaaagatctagatgcaagattatttctggatcatgataaaact
cttcaggctgatcctacagacagttttgaaatgcaaagaacaccacgaaaaagtaaccct
gatgaagaggtgaatatgattcttccacagactccagttagaactgttatgaatactatc
caacaattaatgatgatcttaaattcagcaagtgatcaaccatcggaaaatctgatttcc
tattttaataattgtacagtgaatccaaaggacagtatcctgaaaagagtgaaggatatt
ggggacgtctttaaagagaaatttgctaaagctgtgggacaaggatgtatggaaattgga
tcacagcgatacaaacttggagtccgattgtattaccgagtaatggaatccatgcttaaa
tcagaagaagaacgattatccattcaaaattttagcaaactcctgaatgacaacatcttt
catatgtctttgttggcatgcgctcttgaggttgtaatggctacctatagcagaagtatg
tctcagagcctggatactggaacagatctatccttcccatggattctgaatgtatttaac
ttaaaagcttttgatttttacaaagtgattgaaagtttcatcaaagcagaagccaacctg
accagagaaatgattaaacatttagaacgatgtgaacatcgaatcatggagtcccttgcc
tggctctcagattcacctttatttgatcttattaaacaagcaaaggaccgagaaggacca
gttgatcactttgaacctgcctgtactctcaaccttcctctccagaataatcacactgca
gcagatatgtatctttctcctgtaagatccccaaagaaaaaagggccaactccacgtgta
aattctactccaaattcagaggcacaagcaacctcagccttccagactcagaagccattg
aaatctacctccctttcactcttctacaaaaaagtgtatcgactagcatatcttcgactg
aacaccctgtgtgcacgccttctgtctgaccacccagaactagagcatatcatctggacc
cttttccagcacacactgcaaaatgagtatgaactcatgagagacaggcatttggaccag
attatgatgtgttctatgtatggcatatgcaaagtgaagaatatagaccttaaattcaaa
atcattgtcacagcatacaaagatcttcctcatgctgttcaggagacattcaaacgtgtt
ttgattagagaagaggagtatgattccattatcgtattctataattcggtcttcatgcag
agactgaaaacaaatattttgcagtacgcttccaccaggccccctaccttgtcaccgatt
cctcacattcctcgaagtccttacaagttttctagttcacctttacggattcctgggggg
aacatctatatatcacccctaaataatccatataaaatttcagaaggtctgccgacacca
acaaaaatgactccaagatcaagaatcttagtatcaatcggtgaatcatttgggacttca
gagaagttccagaaaataaatcaaatggtatgtaacagcgaccgcgtgctcaaaagaagt
gctgaaggaagcaaccctcctaaaccactgaaaaaactgcgctttgacatcgaaggatcc
gatgaagcagatggaagtaaacatctcccaggggaatccaaatttcaacagaaactggca
gaaatgacatctactcgaacacgaatgcaaaagcagaaaatgaatgagagcgtggatacc
tcaaacagggaagaaaagtga

DBGET integrated database retrieval system