KEGG   Bos indicus (zebu cattle): 109567013
Entry
109567013         CDS       T04792                                 

Gene name
FLT3
Definition
(RefSeq) receptor-type tyrosine-protein kinase FLT3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04014  Ras signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05221  Acute myeloid leukemia
biu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109567013 (FLT3)
   04014 Ras signaling pathway
    109567013 (FLT3)
   04151 PI3K-Akt signaling pathway
    109567013 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109567013 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567013 (FLT3)
   05202 Transcriptional misregulation in cancer
    109567013 (FLT3)
   05230 Central carbon metabolism in cancer
    109567013 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    109567013 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109567013 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109567013 (FLT3)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     109567013 (FLT3)
Protein kinases [BR:biu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   109567013 (FLT3)
CD molecules [BR:biu04090]
 Proteins
  109567013 (FLT3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 APH
Other DBs
NCBI-GeneID: 109567013
NCBI-ProteinID: XP_019827306
UniProt: A0A6P5CMH7
LinkDB
Position
12
AA seq 1006 aa
MDSLIVVRGLSSCGVHVSTSLPLFAFTVVFSTMIFQTITNQDLPEIKCVLINHGNNDSSV
RTSSSNPMASESREDLACALRPEGTETIYEAATVQVDVSASITLQVLVSAPGNTSCLWVF
KHSYLNCQPHLDLQNRGVFSMVILKMTETQAGEYRLLIQSAATNYTVLFTVSLRNTLLYT
LRKPYFRKMENQDALVCISESVPEPTVEWVFCDSQSDSCKGESPAVVTKEESVLHELFGT
DIRCCARNELGRECTKLFTIDLNQTPQTTPPQLFLKVGEPLWIRCKAIHVNHGFGLSWEL
ENKALEEGSYFEMSTYSTNRTMIRILFAFVSSVGRNDTGYYTCSSSEHPSKSALVTILEK
GFINVSKSNEDYEIDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQSGLDDGYSISKFC
NHKHQPGQYIFHAENDDAQFTKEFTLNIRRKPQVLAEASASQASCSSDGYPIPSWTWKKC
SDKSPNCTEEITEGIWNKKANRKVFGQWISSSTLNMSEAVKGFLVKCCAYNALGTSCETI
LLSSPGPFPSIQDNISFYATIGLCLPFIAVLTMLICHKYKKQFRYESQLQMVQVTGSLDN
EYLYIDFREYEYDLKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLK
EKADSSEREALMSELKMMTHLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKR
EKFHRTWTEIFKEHNFSFYPTFQSHPNSSMPGSREVQIHPDSDPISGFNGNSFQSEDEIE
YENQKRLEEEEDLNVLTFEDLLCFAYQVAKGMEFLEFKSCLHRDLAARNVLVTHGKVAKI
ADFGLARDIMSDSNYVIRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVN
PYPGIPADANFYKLIQSGFKMDQPFYATEEIYFIMQSCWAFDSRKRPSFPNLTSFLGCQL
ADAEEAMYQNMDGRVSERPSVYQNRRPYSREVDLGLPSPQVHSEDS
NT seq 3021 nt   +upstreamnt  +downstreamnt
atggattctctgattgtagtgcgtgggctcagtagttgcggtgtgcatgtatcaacatca
ctgcctttgtttgctttcacagttgttttttccacaatgatattccagactattacaaat
caagatctgcctgagatcaagtgtgttttaatcaaccatggaaacaatgattcatcagtg
aggacatcatcatcaaatcccatggcatcagaatcccgggaagacctggcatgtgcgttg
aggcccgagggcacagagaccatctatgaagcggccacggtgcaggtggacgtgtctgcg
tccatcacactgcaagtactggtctccgccccagggaacacttcctgtctctgggtcttt
aaacacagctacctaaactgccagccacacttggatttacaaaacagaggagttttttcc
atggtcattttgaaaatgacagaaacccaagctggagaataccgacttttgattcagagt
gcagctaccaattacacagtattgtttacagtgagtctaagaaatacactgctttacaca
ttaaggaaaccttactttagaaaaatggaaaatcaggacgccttggtctgcatctcagag
agtgttccagaaccgacggtggaatgggtgttctgcgattcacagagtgacagctgtaaa
ggagagagtccagctgttgtcacgaaggaggagagcgtcctccatgagttatttggaaca
gatatcaggtgctgtgcaagaaacgagctgggcagggaatgtaccaagctcttcactata
gatctaaaccagactcctcagaccacaccgccacaattatttcttaaagtaggggaaccc
ttatggataaggtgcaaagccattcacgtaaaccacggattcgggctcagctgggaatta
gagaataaagcactggaagagggcagctactttgagatgagtacctattccacaaacaga
actatgatacggattctgtttgcttttgtatcatcagtgggaagaaacgacactggctat
tacacttgttcctcttcagagcatcccagtaaatcagctttggtcaccatcctagaaaag
ggatttataaacgtttccaaatcaaatgaagattatgaaattgaccagtatgaagaattt
tgtttttctgtcaggtttaaagcatacccacaaatcagatgtacgtggaccttctctcga
aaatcatttccttgtgagcaaagtggcctggatgatgggtacagcatatctaagttttgc
aaccataaacaccagccaggacagtatatcttccatgcagaaaatgatgacgcccagttc
acaaaagagttcacactgaatataagaaggaaacctcaagtgctggctgaggcatctgca
agtcaggcttcttgctcctctgatgggtaccctataccatcttggacctggaagaagtgc
tcagacaagtcccccaactgcacagaagaaatcacagaaggaatttggaataaaaaggcc
aacaggaaagtgtttggacagtggatatcgagcagcacgctgaacatgagtgaggctgtc
aaagggttcctggtgaagtgttgtgcctataacgccctcggcacgtcctgtgagacaatc
cttctgagctcaccagggcccttcccttccatccaggacaacatctcattctatgcgaca
attggcctctgtcttcccttcattgccgttttaaccatgctgatttgtcacaagtacaaa
aagcaatttcgttacgaaagccagctgcagatggtgcaggtgaccggctctctggataac
gagtacttgtacattgacttcagagaatatgagtatgatctcaaatgggagtttccaaga
gaaaacttagaatttgggaaggtcctggggtcgggtgcttttggaaaagtgatgaatgcg
accgcctacggaattagtaagacaggggtctccatccaggttgcagtcaagatgctgaaa
gaaaaagcagacagctcggagagagaggctctcatgtctgaactcaaaatgatgacccac
ctgggcagccacgagaatattgtgaatctcctgggggcgtgcaccctgtcaggaccaatt
tacttgatttttgaatactgttgctacggcgaccttctcaactatctaagaagtaaaaga
gaaaaatttcacaggacgtggacggagattttcaaggaacataatttcagtttttatccc
actttccaatcacaccctaattccagtatgccaggttcaagagaagttcaaatacacccg
gactcagatcctatctcagggttcaatgggaattcatttcagtctgaagatgaaattgaa
tacgaaaaccaaaaaaggctggaggaagaagaagacctgaatgtactgacctttgaagat
ctcctttgctttgcatatcaagtggccaaaggaatggaatttctggaatttaagtcgtgt
cttcacagagacctggcagccaggaatgtcctggtgacccacgggaaagtggcgaagatc
gctgattttgggctggctcgggatattatgagtgattccaactacgtcatcaggggaaat
gcccgtctgcctgtgaagtggatggcccctgaaagcttgtttgagggcatctacacaatt
aaaagcgatgtctggtcgtatggaatattactctgggaaatattctcgcttggtgtcaat
ccttaccctgggattcccgctgatgctaacttctacaaactcatccagagtgggttcaag
atggaccagccattttatgccacggaagaaatatactttataatgcaatcctgctgggct
tttgactccaggaaacgaccatccttccctaacctgacttcatttttagggtgtcagctg
gcagatgcagaagaagcgatgtatcagaacatggatggccgtgtttcagagcgtccttct
gtttaccaaaacaggcgaccttacagcagagaggtggacttggggctaccctctcctcag
gttcacagtgaagattcctag

DBGET integrated database retrieval system