KEGG   Bos indicus (zebu cattle): 109567220Help
Entry
109567220         CDS       T04792                                 

Gene name
TGM3
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase E
  KO
K05620  transglutaminase 3 [EC:2.3.2.13]
Organism
biu  Bos indicus (zebu cattle)
Brite
KEGG Orthology (KO) [BR:biu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    109567220 (TGM3)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109567220 (TGM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 109567220
NCBI-ProteinID: XP_019827547
LinkDB All DBs
Position
13
AA seq 691 aa AA seqDB search
MSGLQSVDWQIASNRQAHHTERFYGKDLLVRRGQLFQVSLTLSQGLSSGGRVTFTASTGP
YPSESANTKAVFPLSNGTSSSGWGAQLVSSRNNVLNISILSPANAPIGRYTLNMQISSQG
SDSTXKLGTFILLFNPWLQADSVFMSNHAEREEYVQEDAGIIFVGSTNRISMIGWNYGQF
EEGILNICLSVLDNSLNFRRDPATDVAHRNDPKYVGRVLSAMINGNDDSGVISGNWSGNY
TGGRDPRNWNGSVEILKEWQRSGFRPVRYGQCWVFAGTLNTVLRCLGIPSRVITNFNSAH
DTDQNLSVDVYYDPLGRPMDKGSDSVWNFHVWNEAWFVRSDLGPSYNGWQVLDATPQERS
QGVFQCGPASVIAIREGNVDWDFDMPFIFAEVNADRITWIYESNGALKKNSXDTHSVGKY
ISTKAVGSNSRMDVTEKYKYPEGSSQERQVFEKALRKLKPTMSFSATSASSLAREEREPS
ISGRFKVAGVLTVGKEVNLILMLKNLTSDTKTVTVNMTAWTIVYNGTLVHEVWKDSVTKS
LNPEEEIEHPVKIAYAQYEKYLKADNMIRTTAVCQVTDEPEVVVERDIILDNPTLTLEVL
DEARVQKPVNVQMLFSNPLDEPVKDCVLMVEGSGLLLGNLKIDVPALRPKERSRVRFEIL
PTRSGTKQLLANFSCNKFPAIKAMLSVDVAE
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctggactccagagtgtcgactggcagatagcctccaaccggcaggcacatcacaca
gagaggttctacggcaaggatctcctggtacggagaggccaactcttccaagtgtcactg
accttatcccaaggtctcagctctggaggacgtgtgacattcacagcttccacagggcct
tacccctcagagtcggccaatacaaaggctgtgtttccactctccaatgggacaagtagc
agcggctggggtgcacaacttgtgtccagcaggaacaatgttctgaacatctccatcctt
agtcctgcaaatgcacccattggaaggtacacgctaaacatgcagatctcctcccagggc
agtgactccacgmtgaaacttgggacattcatactgctctttaacccctggttgcaagct
gatagtgtctttatgagtaaccaygctgagagagaggaatatgttcaggaagatgctggc
atcatctttgtgggaagcacaaatcgaattagcatgattggctggaactacggacagttt
gaagaaggcatcctgaacatttgcctctcagtcctggataacagtctgaattttcgccgt
gaccctgctacggatgtggcccacagaaacgatcccaaatatgttggccgggttctcagt
gcaatgatcaatggcaatgatgacagtggcgtgatttctgggaactggagcggtaactac
actggtggccgggatcctaggaactggaatggcagcgtggaaatcctcaaggagtggcaa
agatctggcttcaggcctgtccgatatggccagtgctgggtctttgctggaaccctcaac
acagtgttgcgatgtttggggattccctcccgagtgatcaccaacttcaactcagctcat
gacacagaccaaaacctcagtgtggatgtctactacgaccccttgggacggcccatggac
aaaggcagtgatagtgtgtggaatttccacgtctggaatgaagcctggtttgtgcggtct
gacctgggcccttcgtacaatggatggcaggttctggaygccacccctcaggagagaagc
caaggggtgttccagtgcggccctgcttcggtgatcgctatccgagagggtaatgtggac
tgggacttcgacatgcccttcatctttgcggaggtcaatgccgaccgcatcacatggatc
tacgagtcgaacggtgccttgaagaagaattcckcagacactcacagcgtcggcaagtac
atcagtaccaaggcggtgggcagcaactctcgcatggatgtcaccgaaaagtacaagtat
ccagaaggttccagccaggaaagacaagtatttgaaaaggctttgaggaaacttaaaccc
acaatgtcatttagtgcaacatctgcaagcagcctggcaagagaggaacgggagcctagc
atctctgggaggttcaaggtcgctggtgtactgacagtgggcaaagaagtcaacctgatc
ctaatgctcaaaaacctaacaagtgatacaaagacagtgacagtgaatatgacagcctgg
accatcgtctacaacggcacacttgtacacgaggtgtggaaggactctgtcactaaatcc
ctgaatcccgaagaagaaatagagcaccctgtaaagatcgcatatgctcagtacgagaag
tacctgaaggcggacaacatgatccggaccacagccgtgtgccaggtcaccgatgagcct
gaggtggtggtggagagggacatcatcctggacaaccccaccttgacccttgaggtgctg
gatgaggcccgggtgcagaagcctgtgaacgtgcagatgctcttttccaacccactggat
gagcccgtgaaggactgcgtgctgatggtggagggcagcggcctgctgctgggcaatctc
aagatcgacgtgccagccctgcgtcccaaagagcggtcccgcgtgcgttttgagatcctg
cccacccggagtggcaccaagcagctccttgccaacttctcctgcaacaagttccccgca
atcaaggccatgctgtccgttgatgtggctgagtga

DBGET integrated database retrieval system