KEGG   Bos indicus (zebu cattle): 109567436Help
Entry
109567436         CDS       T04792                                 

Gene name
TGM2
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 2
  KO
K05625  transglutaminase 2 [EC:2.3.2.13]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:biu00001]
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    109567436 (TGM2)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     109567436 (TGM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core A2M_N
Motif
Other DBs
NCBI-GeneID: 109567436
NCBI-ProteinID: XP_019827962
LinkDB All DBs
Position
13
AA seq 687 aa AA seqDB search
MAEELVLERCDLELEANGRDHHTADLCRERLVVRRGQPFWLTLHFEGRNYEASVDSLTFC
AVTGPDPSEEAGTKALFRLSDATEEGAWAAVAADQRDSTLSLHLSTPANAPVGHYRLSLE
ASTGYQGSSFMLGQFTLLFNSWCPADAVYLDSDEERQEYVLTQQGFIYQGSAKFIKNIPW
NFGQFEEGILDICLMLLDVNPKFLRNAGRDCSRRSSPVYVGRVVSGMVNCNDDQGVLLGR
WDNNYADGISPMSWIGSVDILRRWKRDGCQRVKYGQCWVFAAVACTVLRCLGIPTRVVTN
YNSAHDQNSNLLIEYFRNEFGEIQSDKSEMIWNFHCWVESWMTRPDLQPGYEGWQALDPT
PQEKSEGTYCCGPVPVRAIKEGDLSTKYDAPFVFAEVNADVVDWIRQDDGSLHKSINHSL
VVGLKISTKCVGRDDREDITHSYKYPEGSPEEREAFTRANHLNKLVNKEETGVAMRIRVG
EGMNRGCDFDVFAHITNSTPEEHTGRLLLCARTVSYNGILGPECGTKDLLSLSLEPYSEK
SIPLRILYEKYCDCLTESNLIKVRGLLIEPAANSYLLAERDIYLENPEIKIRILGEPKQN
RKLVAEISLQNPLTVALSGCTFTVEGAGLIEEQKTVDIPDPVEAGEEVKVRVDLLPLYVG
RHKLVVNFESDRLKAVKGFRNVIVGPS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagctggtcctggagagatgtgacctggagctggaggccaatggccgtgac
caccacacagctgacctgtgcagggaaaggctggtagtgcggcggggccagcccttctgg
ctgactctgcactttgagggccggaactatgaggccagcgtggacagcctcaccttytgt
gctgtgactggcccagaccccagtgaggaggccgggaccaaggccctcttcaggctgtcc
gatgctacggaggagggggcctgggcrgcggtggcagcggaccagcgagacagcaccctc
tcgctgcacctcagcaccccggccaatgcccccgttggccattaccgcctcagcttggag
gcctccactggytaccagggctccagtttcatgctgggtcagttcaccctgctcttcaac
agctggtgtccagcggatgctgtgtacctggactcagatgaggagcggcaagaatacgtc
cttacccagcaaggcttcatctaccagggctcagccaagttcatcaagaacataccttgg
aattttgggcagtttgaagaagggatcctagacatctgcctgatgctcctggaygtcaac
cccaagttcctgaggaatgccggccgagactgctcccgccgcagtagtccrgtctatgtg
ggccgggtggtgagcggcatggtcaactgcaacgatgaccagggcgtgctgctggggcgc
tgggacaacaactacgcrgacggcatcagccccatgtcctggatcggcagygtggacatc
ctgcggcgctggaagagagatggctgccagcgcgtcaagtacggccagtgctgggtgttc
gcggctgtggcctgcaccgtgctgcggtgccttggcatccctacccgagtcgtgaccaac
tataactcagcccatgaccagaacagcaacctgctcatcgagtacttccgcaatgagttc
ggggagatccagagtgacaagagcgagatgatctggaacttccactgctgggtggagtcg
tggatgaccaggccagacctgcagccggggtacgaggggtggcaggccctcgaccccacg
ccccaggagaagagcgaagggacttactgctgtggcccggttcccgttcgtgccatcaag
gagggtgacctgagcaccaaatacgacgcccctttcgtctttgccgaagtcaacgctgac
gtggtggactggatccggcaggacgatgggtctctgcacaaatccatcaaccactccctg
gtggtggggctgaagatcagcacaaagtgtgtgggcagagatgatcgggaggacatcacc
cacagctacaagtacccggaggggtccccagaggaaagggaagccttcacaagagccaac
catctgaacaaactggttaacaaagaggagacaggggtggccatgcggatccgtgtgggc
gagggcatgaacagaggctgcgacttcgacgtctttgcccacatcaccaacagcaccccy
gaggagcacactggccgcctcctgctctgtgcccgcactgtcagctacaatgggatcctg
ggacctgagtgcggcaccaaggatctgctcagcctttccctggagccctactctgagaag
agcattccccttcgaatcctctacgaaaagtactgtgattgcctgaccgaatcgaacctt
atcaaggtgcggggcctccttattgagccagctgccaatagctacctgctggccgagagg
gacatctacctggagaacccagaaatcaagatccggatcctgggagagcccaagcagaac
cgcaagctggtggctgagatatctctgcagaacccgctcactgtggcgctgtcgggctgc
accttcactgtggagggagcaggcctgattgaggagcagaagactgtggacatcccagac
cccgtggaagcaggggaggaagtcaaggtgagggtggacctgctgcctctgtacgtgggc
cgccacaagctggtggtgaacttcgagagcgataggctgaaggccgtgaagggcttcagg
aacgtcatcgttggcccctcctaa

DBGET integrated database retrieval system