KEGG   Bos indicus (zebu cattle): 109567597
Entry
109567597         CDS       T04792                                 

Gene name
STAM2
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducing adapter molecule 2
  KO
K04705  signal transducing adaptor molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567597 (STAM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109567597 (STAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109567597 (STAM2)
Membrane trafficking [BR:biu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    109567597 (STAM2)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM ENTH GAT
Other DBs
NCBI-GeneID: 109567597
NCBI-ProteinID: XP_019828190
UniProt: A0A6P5CR78
LinkDB
Position
2
AA seq 526 aa
MPLFTANPFEQDVEKATNEYNTTEDWSLIMDICDKVGSTPNGAKDCLKAIMKRVNHKVPH
VALQALTLLGACVANCGKIFHLEVCSRDFATEVRAVIKNKAHPKVCEKLKSLMVEWSEEF
QKDPQFSLISATIKSMKEEGITFPPSGSQTVSAAAKNGTSSNKNKEDEDIAKAIELSLQE
QKQQHTETKSLYPSAEIQSNNKVARKVRALYDFEAVEDNELTFXHGEIIIVLDDSDANWW
KGENHRGIGLFPSNFVTCNLNIESEAAAVDKLNIIDDEEEEIKKSEPEPVYIDEDKMDRA
LQVLQSIDPTDSKPDSQDLLDLEDICQQMGPMIDEKLEEIDRKHSELSELNVKVLEALEL
YNKLMNEAPVYAVYSKIHHPAHYPTSSAGVPIQTYPVQPHGGNYMGQSIHQVTVAQSYSL
GPDQIGPLRSLPPTVNSSVTTQPAQTPYLSTGQDTISNPTYMNQNSNLQSAPGAAAYTQQ
MGMSVDMSSYQNATSNLPQLAGFPVAVPAHSVAQQQTNYHQQQPLL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgcctctgttcaccgccaaccctttcgagcaagatgtggaaaaggctacaaatgagtac
aacactacagaagattggagtcttattatggatatatgtgacaaagttggaagcactcct
aacggagcaaaagattgcctaaaagccataatgaaaagggtaaatcataaagttcctcat
gttgctctgcaggcattaactcttcttggggcttgtgtggcaaactgtggaaagatattt
catttagaagtgtgttcccgtgattttgcaacagaagtacgtgctgtgataaaaaataag
gctcatcctaaagtatgtgaaaaactgaaatctttaatggtagaatggtcagaagaattt
cagaaggaccctcagtttagtctaatatctgcaactattaaatctatgaaagaagaagga
attacttttcctccatcaggttctcagactgtctcagctgctgccaaaaacggtacatca
tcgaacaaaaacaaagaagatgaagatatagctaaagctattgaattatcattgcaagag
cagaagcagcagcacacagaaacaaaatccttatatccatctgcagaaattcagtcaaat
aataaagttgcaaggaaagtgagagctttatatgattttgaagccgttgaggacaatgaa
ctcacttttnaacacggtgaaattattattgttttggatgacagtgatgctaattggtgg
aaaggagaaaatcacagaggaattggactcttcccatctaattttgtaacatgtaattta
aacatagaatcagaggcagcagctgtggacaaattgaatataattgatgatgaggaggag
gaaattaagaaatcagagcctgagcctgtttatatagatgaggataagatggatagagcc
ctgcaggtactgcagagtatagatccaacagattcaaaaccagattctcaagacctcttg
gacttagaagatatctgccaacagatgggtccaatgatagatgaaaaacttgaagagatt
gataggaagcattcagaattgtctgaattgaatgtaaaagtcttagaagctctggaactt
tataataagttgatgaatgaagcgccagtatatgcagtctattcaaagatccaccatcca
gcacattacccaacttcatcagctggagttccaattcagacatacccagttcaaccacat
ggtggaaactatatgggtcaaagtattcaccaagtcactgttgcccaaagctacagccta
ggaccagatcagattggtccactgagatctctgcctccaactgtgaattcctcagtgaca
acacagcctgctcaaactccgtacttaagcactggacaagacactatttccaatcctact
tacatgaaccagaactctaaccttcaatcagctcctggtgcagctgcttacacacagcag
atggggatgtctgtggatatgtcatcttaccagaacgctacttccaacttgccgcagttg
gcaggctttccrgtggcagttccagctcattcagttgcacagcagcaaacaaattaccat
caacagcagcctctcctttaa

KEGG   Bos indicus (zebu cattle): 109567984
Entry
109567984         CDS       T04792                                 

Gene name
STAM
Definition
(RefSeq) signal transducing adapter molecule 1 isoform X1
  KO
K04705  signal transducing adaptor molecule
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04144  Endocytosis
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567984 (STAM)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109567984 (STAM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109567984 (STAM)
Membrane trafficking [BR:biu04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-0 complex
    109567984 (STAM)
SSDB
Motif
Pfam: VHS SH3_1 SH3_9 SH3_2 UIM GAT SH3_10
Other DBs
NCBI-GeneID: 109567984
NCBI-ProteinID: XP_019828676
UniProt: A0A6P5CRI2
LinkDB
Position
13
AA seq 534 aa
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPH
VAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFK
NDPQLSLISAMIKNLKEQGVTFPAIGSQAAEQAKASPALVAKDPGTAANKKEEEDLAKAI
ELSLKEQRQQSTTLSTLYPSTSNLLTNHQHEGRKVRAIYDFEAAEDNELTFKAGEIITVL
DDSDPNWWKGETHQGMGLFPSNFVTADLTVEPEMIKTEKKTVQFSDEVQVETIEPEPEPA
YIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSEL
NVKVMEALSLYTKLMNEDPMYSMYAKLQNQQYYIQSSGVSGSQVYPPQSGAYLVAGSAQM
SHLQSYSLPPEQLSSLSQGAVPPSANPALPTQQAQASYPSTMVSSVPGSTYPSQASVYSP
PPAATAAPDVTIYQNTGTSLSQVPNYTLPSTLPQPGGSQQPPQPQQPYSQKALL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atgcctctgtttgccaccaatcccttcgatcaggatgtcgagaaagcaaccagtgagatg
aatactgctgaggattggggcctcattttggatatttgtgataaagtcggtcagtctcgc
actggacctaaagattgtcttcggtctattatgaggagggtaaaccataaagatcctcat
gtggctatgcaggctctcactcttctaggagcatgtgtatcaaactgtggcaaaattttt
cacttagaagtatgttcgagagattttgctagtgaagtaagcaacgtattaaacaagggt
catcctaaagtatgtgaaaaattgaaggctcttatggttgaatggacggatgaattcaag
aatgatccacagctcagtctgatatcagcaatgattaagaacctgaaagaacagggtgtt
acatttcccgctattggctctcaggctgcagaacaagcgaaagcaagcccagctctggta
gccaaggatcctggtactgcggctaacaaaaaagaagaggaagatttagcgaaagccatt
gagttgtccctgaaggaacaaaggcagcagtcaaccaccctttccactttgtatccaagc
acatccaacctcttaactaaccatcaacatgaaggccggaaagttcgtgctatatacgac
tttgaagctgctgaagataatgaactgacttttaaagctggagaaattattacagttctt
gatgacagtgaccccaactggtggaaaggggaaacccatcaaggcatggggctcttccct
tcaaattttgtgactgcagatctcactgttgagcctgaaatgattaaaacagagaagaag
acggtacaatttagtgatgaagttcaggtagaaacgatagaaccagagccagaaccagcc
tacattgatgaggataaaatggaccagttgctacagatgttgcaaagtacagatcccagt
gatgatcaaccagatcttccagagttacttcatcttgaagcaatgtgtcaccagatgggg
cctctcattgatgagaagctggaggatattgatagaaaacattcagaactctcagaactg
aatgtgaaagtgatggaagccctgtccttgtataccaagttaatgaatgaagaccccatg
tattccatgtatgcaaaattacagaatcagcagtattatattcagtcatctggagtttct
ggttctcaggtgtaccctcctcagagtggtgcttacctggtcgcagggagcgcccagatg
agccacctgcagagctacagcctacccccagagcagctgtcttccctcagccaaggagca
gtgccaccatctgcaaacccagcccttcctactcagcaagcccaggcttcctaccccagc
acaatggtcagctccgtcccgggaagtacgtatcccagccaggcttcagtgtacagtcct
ccccctgctgccacagctgctcccgacgtcaccatctaccagaacacagggaccagcctg
tcccaggtgccgaactatacattaccgtccacactgccccagcctgggggcagccagcag
ccacctcagccgcagcagccgtactcccagaaggctctgctatag

DBGET integrated database retrieval system