KEGG   Bos indicus (zebu cattle): 109567683
Entry
109567683         CDS       T04792                                 

Gene name
E2F1
Definition
(RefSeq) transcription factor E2F1
  KO
K17454  transcription factor E2F1
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04110  Cell cycle
biu04137  Mitophagy - animal
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    109567683 (E2F1)
  09143 Cell growth and death
   04110 Cell cycle
    109567683 (E2F1)
   04218 Cellular senescence
    109567683 (E2F1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567683 (E2F1)
   05206 MicroRNAs in cancer
    109567683 (E2F1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109567683 (E2F1)
   05225 Hepatocellular carcinoma
    109567683 (E2F1)
   05226 Gastric cancer
    109567683 (E2F1)
   05214 Glioma
    109567683 (E2F1)
   05220 Chronic myeloid leukemia
    109567683 (E2F1)
   05218 Melanoma
    109567683 (E2F1)
   05219 Bladder cancer
    109567683 (E2F1)
   05215 Prostate cancer
    109567683 (E2F1)
   05224 Breast cancer
    109567683 (E2F1)
   05222 Small cell lung cancer
    109567683 (E2F1)
   05223 Non-small cell lung cancer
    109567683 (E2F1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109567683 (E2F1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567683 (E2F1)
   05161 Hepatitis B
    109567683 (E2F1)
   05160 Hepatitis C
    109567683 (E2F1)
   05163 Human cytomegalovirus infection
    109567683 (E2F1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109567683 (E2F1)
   05169 Epstein-Barr virus infection
    109567683 (E2F1)
   05165 Human papillomavirus infection
    109567683 (E2F1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109567683 (E2F1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109567683 (E2F1)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109567683 (E2F1)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP TP1
Other DBs
NCBI-GeneID: 109567683
NCBI-ProteinID: XP_019828272
UniProt: A0A6P5CTV8
LinkDB
Position
13
AA seq 579 aa
MGRSLEVGLRTQKRGGAVSRDLAEGVGATVSPLRGIGQMGVRRGGGGATTPRTGAVPSEG
GECKRAWHRPDKACARPDPRLAVLPRAAAPSRPPPPWPGLCRQRRPGAERDPERDLALAS
TCRHGPAPPPPTATRAARAVSXXXXXXXXXXXXXXXXXXXXXXXXALRLLDSSQIVIIST
AQDASAPPAPAGPAAPAAGPRHPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLNLETDH
QYLAESSGPARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAE
VLKVQKRRIYDITNVLEGIHLIAKKSKNHIQWLGSHATVGISGRLEGLTQDLQQLQESEQ
QLDHLLHTCSTQLRLLSEDADSQRLAYVTCQDLRSIADPAEQMVMVIKAPPETQLQAVDS
SENFQISLKSKQGPIDVFLCPEESVGGTSPGKTPSQGAASGEEDRTADLATAVPPPPSSP
RSSPATDPSQSLLSLEQEPLLSRMGGLRAPVDEDRLSPLVAADSLLEHVKEDFSSLLPEE
FITLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgggccggagcttggaggtgggcctgagaacccagaagagaggaggggcagtttctaga
gatctggccgagggtgttggggccacagtgtctccacttagaggcatcgggcagatgggg
gtgcgtcggggaggrggtggggccaccacgcctcggacaggggccgtcccctctgagggc
ggggagtgcaaacgcgcctggcaccgccccgacaaagcttgcgcgcgccccgacccccga
ttggccgtgctgcctcgcgccgccgccccgtcccgccctccgccgccgtggccgggactt
tgcaggcagcggcggccgggggcggagcgggatccggagcgggatctagccctcgcctcg
acctgccgccatgggcccgcgccgccgccgccgactgccacccgcgccgcgcgggccgtg
agcgnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnngcgctgcggctgctcgactcctcgcagatcgtcatcatctccacc
gcgcaggacgccagcgccccgccggcccccgccggccccgccgcacccgccgccggcccc
cgccaccctgacctgctgctcttcgccacgccgcaggcgccccggcccacacccagcgcg
ccgcgccccgcgctcggccgcccgccggtgaagcggaggctgaacctggaaactgaccat
caatacctggctgagagcagcgggccagctcggggcagaggccgccacccaggaaaaggt
gtgaagtccccaggggagaagtcacgctacgaaacatcattgaacctgaccaccaaacgc
ttcttggaattactgagccgctcggctgatggagtggtcgacttgaactgggcggcagag
gtgctgaaggtgcagaaacggcgcatctacgacatcaccaacgtcctggagggcatccac
ctcatcgcgaagaagtccaagaaccacatccagtggctaggcagccatgcaacggtgggg
atcagcgggcggcttgaaggattgacccaggacctccagcarctgcaggagagtgagcag
cagctggatcacctgctccacacctgcagcacccagctgcgtctgctctcggaggacgct
gacagccagcgcctggcctatgtgacctgccaggaccttcgtagcatcgcagaccctgca
gagcagatggtcatggtgatcaaggccccccctgagacccagctccaagccgtggactcc
tcggagaactttcagatctcccttaagagcaaacaaggccccatcgacgttttcctgtgc
cctgaggagagtgtgggtggaaccagccctggaaagaccccgtcccagggggcagcttcg
ggggaggaggacaggacagctgaccttgccactgcggtgccaccaccaccatcatcaccc
cgctcatcccctgccacagatcccagtcagtccctgctcagcctggagcaagaacctctg
ctttcccggatgggcggcctgcgggcccccgtggacgaggaccgcctatccccgctcgtg
gcggccgactcactcctggagcacgtgaaggaggacttctccagcctcctccccgaggag
ttcatcaccctgtcccccccccacgaggccctcgactaccactttggcctcgaggagggt
gagggcatcagagacctcttcgactgtgactttggggacctcactcccctggatttctga

KEGG   Bos indicus (zebu cattle): 109576116
Entry
109576116         CDS       T04792                                 

Gene name
E2F2
Definition
(RefSeq) transcription factor E2F2
  KO
K09389  transcription factor E2F2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04110  Cell cycle
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109576116 (E2F2)
   04218 Cellular senescence
    109576116 (E2F2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109576116 (E2F2)
   05206 MicroRNAs in cancer
    109576116 (E2F2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109576116 (E2F2)
   05225 Hepatocellular carcinoma
    109576116 (E2F2)
   05226 Gastric cancer
    109576116 (E2F2)
   05214 Glioma
    109576116 (E2F2)
   05220 Chronic myeloid leukemia
    109576116 (E2F2)
   05218 Melanoma
    109576116 (E2F2)
   05219 Bladder cancer
    109576116 (E2F2)
   05215 Prostate cancer
    109576116 (E2F2)
   05224 Breast cancer
    109576116 (E2F2)
   05222 Small cell lung cancer
    109576116 (E2F2)
   05223 Non-small cell lung cancer
    109576116 (E2F2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109576116 (E2F2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109576116 (E2F2)
   05161 Hepatitis B
    109576116 (E2F2)
   05160 Hepatitis C
    109576116 (E2F2)
   05163 Human cytomegalovirus infection
    109576116 (E2F2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109576116 (E2F2)
   05169 Epstein-Barr virus infection
    109576116 (E2F2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109576116 (E2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109576116 (E2F2)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109576116 (E2F2)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109576116
NCBI-ProteinID: XP_019840069
UniProt: A0A6P5DQE0
LinkDB
Position
2
AA seq 367 aa
MLLKLCLSLLSLPKAKRKLDLEGIGRPTVPEFRTPKGKCIRVDGLPSPKTPKSPGEKTRY
DTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNI
QWVGRGLFEDPTRPGKQQQLGQELKELMNMEQALDQLIHSCSLNFKHLTEDKANKRLAYV
TYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRSEENLQIHLKSTQGPIEVYLCPEEVQEP
HSPAKEPLPSTSALSPSPDSTQLNSNSDPGITEPTASSEPALTSPQVPPPPPPPLVPLEA
TENMLELPHPLLQQTEDQFLSPTLPCSSPLISFSPPLDQDDYLWGLDGGEGISDLFDTYD
LGDLLIN
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgcttctcaaactctgcctctctctcctctctctccccaaggccaaaaggaagctggac
ctggaggggatcgggaggcccacggtccctgaattccggactcccaaggggaagtgcatt
agagtggatggcctccccagccccaaaacccccaagtcccccggagaaaagactcgctat
gacacatcgctggggctgctcaccaagaaattcatttacctcctgagtgagtctgaggat
ggggttctggatctgaactgggctgccgaagtgctggacgtgcagaagcggcgcatctac
gacatcaccaacgtgctggagggcatccagctcatccgcaagaaggccaagaacaacatc
cagtgggtgggcaggggactgtttgaagaccccacgcggcctgggaagcagcagcagctg
gggcaggagctgaaggagctgatgaacatggagcaggccctggaccagctcatccacagc
tgctctctgaacttcaagcacctgacggaggacaaggccaacaagagactggcctacgtg
acgtaccaggacatccgtgctgtgggcaactttaaggagcagacggtgattgcggtcaag
gcccctccgcagactagactggaggtgcctgacaggagtgaggagaacctgcagatacat
ctgaagagcacacaggggcccatygaggtttacctgtgcccagaagaggtgcaggagccc
cacagtcctgccaaggagcccctcccctccacttccgccctcagccccagccctgactcc
acccagctcaacagcaacagcgaccctgggatcacggaacccacggcatcctcagagcca
gcactgacgtccccgcaggtcccrccgccacccccgccgccccttgtccccctggaggcc
acggagaacatgctggagctgccgcacccgctgctgcagcagacggaggaccagttcctg
tccccaacgctgccctgcagctcccctctgatcagcttctccccgcccttagaccaggat
gactacctgtggggcctggacggcggggagggcatcagcgacctctttgatacctacgat
ctcggggacctgctgattaactga

KEGG   Bos indicus (zebu cattle): 109577245
Entry
109577245         CDS       T04792                                 

Gene name
E2F3
Definition
(RefSeq) transcription factor E2F3
  KO
K06620  transcription factor E2F3
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04110  Cell cycle
biu04218  Cellular senescence
biu04934  Cushing syndrome
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05206  MicroRNAs in cancer
biu05212  Pancreatic cancer
biu05214  Glioma
biu05215  Prostate cancer
biu05218  Melanoma
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109577245 (E2F3)
   04218 Cellular senescence
    109577245 (E2F3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109577245 (E2F3)
   05206 MicroRNAs in cancer
    109577245 (E2F3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    109577245 (E2F3)
   05225 Hepatocellular carcinoma
    109577245 (E2F3)
   05226 Gastric cancer
    109577245 (E2F3)
   05214 Glioma
    109577245 (E2F3)
   05220 Chronic myeloid leukemia
    109577245 (E2F3)
   05218 Melanoma
    109577245 (E2F3)
   05219 Bladder cancer
    109577245 (E2F3)
   05215 Prostate cancer
    109577245 (E2F3)
   05224 Breast cancer
    109577245 (E2F3)
   05222 Small cell lung cancer
    109577245 (E2F3)
   05223 Non-small cell lung cancer
    109577245 (E2F3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109577245 (E2F3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109577245 (E2F3)
   05161 Hepatitis B
    109577245 (E2F3)
   05160 Hepatitis C
    109577245 (E2F3)
   05163 Human cytomegalovirus infection
    109577245 (E2F3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109577245 (E2F3)
   05169 Epstein-Barr virus infection
    109577245 (E2F3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109577245 (E2F3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109577245 (E2F3)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix cell cycle-controlling factors, E2F
    109577245 (E2F3)
SSDB
Motif
Pfam: E2F_CC-MB E2F_TDP
Other DBs
NCBI-GeneID: 109577245
NCBI-ProteinID: XP_019841676
UniProt: A0A6P5DTT3
LinkDB
Position
23
AA seq 340 aa
MPLQQQAKRRLELGESGQQYLSDGLKTPKGKGRAALRSPDSPKTPKSPSEKTRYDTSLGL
LTKKFIQLLSQSPDGVLDLNKAAEVLKVQKRRIYDITNVLEGIHLIKKKSKNNVQWMGCS
LSEDGGMLAQCQGLSKEVTELSQEEKKLDELIQSCTLDLKLLTEDSENQRLAYVTYQDIR
KISGLKDQTVIVVKAPPETRLEVPDPIESLQIHLASTQGPIEVYLCPEETETHSPMKTNN
QDHNGNIPKPTSKDLASTNSGHSDCSISMANLSPLASPANLLQQTEDQIPSNLEGPFVNL
LPPLLQEDYLLSLGEEEGISDLFDAYDLEKLPLVEDFMCS
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgcccttacagcagcaggcaaagcgcaggctggagctaggagaaagcggccagcagtac
ctctcagatggtttaaaaacccccaagggcaaaggaagagctgcactccggagtccagac
agcccaaaaactccaaaatctccctcagaaaaaacacggtatgatacatcccttggtctg
ctcaccaagaagttcattcagctcctgagccagtcacctgatggggtcttggatttgaac
aaggcggcagaggtgctgaaggtgcaaaagagaaggatttacgacatcaccaacgtcctg
gaaggcatccacctcattaagaagaagtctaaaaacaacgtgcagtggatgggctgcagt
ctgtctgaggacgggggcatgctggcccagtgtcaaggcctgtcaaaagaagtgaccgag
ctcagtcaggaagagaagaaattagatgaactgatccaaagctgcaccctggacctcaaa
ctgttaaccgaggattcagagaatcaaaggttagcttatgttacatatcaagatattcga
aaaattagtggccttaaagaccaaactgttatagttgtgaaagcccctccagaaacaaga
cttgaagtgcctgacccaatagagagcctacaaatacatttggcaagtacccaaggaccc
attgaggtttatttgtgtccagaagagactgaaacacacagtccaatgaaaacaaacaac
caagaccacaatgggaatatccctaaacccacttccaaagacttggcttcaaccaactca
ggacatagtgattgctcgatttctatggcaaacctttctcctctggcctccccggccaac
cttttacagcagactgaggaccaaattccttccaacctagaaggaccatttgtgaactta
ctgcctcccctgctccaagaagactatctcctaagcctcggggaggaagaaggcatcagc
gatctctttgatgcttacgatttggaaaagctcccgctggtggaagacttcatgtgtagt
tga

DBGET integrated database retrieval system