KEGG   Bos indicus (zebu cattle): 109567961
Entry
109567961         CDS       T04792                                 

Gene name
IL2RA
Definition
(RefSeq) interleukin-2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04061  Viral protein interaction with cytokine and cytokine receptor
biu04144  Endocytosis
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109567961 (IL2RA)
   04151 PI3K-Akt signaling pathway
    109567961 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109567961 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    109567961 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109567961 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109567961 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    109567961 (IL2RA)
   04659 Th17 cell differentiation
    109567961 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109567961 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109567961 (IL2RA)
   05162 Measles
    109567961 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109567961 (IL2RA)
   04090 CD molecules [BR:biu04090]
    109567961 (IL2RA)
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL2 receptor family
   109567961 (IL2RA)
CD molecules [BR:biu04090]
 Proteins
  109567961 (IL2RA)
SSDB
Motif
Pfam: Sushi
Other DBs
NCBI-GeneID: 109567961
NCBI-ProteinID: XP_019828629
UniProt: A0A6P5CTU9
LinkDB
Position
13
AA seq 275 aa
MEPSLLMWRFFVFIMVPGCVTEACHDDPPSLRNAMFKVFRYEVGTMINCDCKTGFRRVSA
VMRCVGDSSHSAWENRCFCNSTSPAKNPVKQVTPAPEEQREKKPTDAQNQTQPPEEADLP
GHCEEPPPWEHEREPLKRVYHFTLGQTVHYQCAQGFRALQTSPAESTCMMINGELRWTRP
RLKCIREGEHGQASDDAEPQESTEAPPGSGTFLPTRMAGTTDFQKPTDEIATLDTFIFTT
EYQIAVAGCTLLLASILLLSCLTWQRKWKKNRRTI
NT seq 828 nt   +upstreamnt  +downstreamnt
atggagccaagcttgctgatgtggaggttcttcgtattcatcatggtacctggctgcgtg
acagargcttgtcatgatgaccctccgagtctcagaaacgccatgttcaaggtcttcagg
tacgaggtgggcaccatgataaactgcgactgcaagacaggcttccgcagagtgtcggcc
gtcatgcgctgcgtgggggactccagccactctgcctgggaaaacagatgcttctgcaac
agcactagccctgctaagaacccagtaaaacaagtcactcctgcacccgaagaacagagg
gagaaaaaacccacagatgcgcagaaccaaacgcagcctccggaggaagctgaccttcca
ggtcactgtgaggaaccgccaccatgggaacacgaacgtgaacctttaaagagagtctac
catttcacgctggggcagacggttcattaccagtgcgcccagggattcagggccctacag
accagtcctgctgaaagcacctgcatgatgatcaacggggagctgaggtggaccaggccc
aggctcaagtgcatacgtgaaggggagcacggtcaggcttcagatgacgcagagcctcag
gagagcacggaagctccccctgggagtggaactttcttaccaaccaggatggcagggacc
acagatttccagaagcccacagatgagattgcaacgctggatacgttcatatttaccact
gagtaccagattgcagtggccggctgcaccctcctgctcgccagcatcctcctcctgagc
tgcctcacctggcagcggaaatggaagaagaacagaaggacaatatag

DBGET integrated database retrieval system