KEGG   Bos indicus (zebu cattle): 109568096Help
Entry
109568096         CDS       T04792                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00010  Glycolysis / Gluconeogenesis
biu00030  Pentose phosphate pathway
biu00051  Fructose and mannose metabolism
biu00052  Galactose metabolism
biu01100  Metabolic pathways
biu01200  Carbon metabolism
biu01230  Biosynthesis of amino acids
biu03018  RNA degradation
biu04152  AMPK signaling pathway
biu05230  Central carbon metabolism in cancer
Module
biu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109568096 (PFKP)
   00030 Pentose phosphate pathway
    109568096 (PFKP)
   00051 Fructose and mannose metabolism
    109568096 (PFKP)
   00052 Galactose metabolism
    109568096 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109568096 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109568096 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    109568096 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109568096 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:biu03019]
    109568096 (PFKP)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109568096 (PFKP)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109568096 (PFKP)
Messenger RNA biogenesis [BR:biu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109568096 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 109568096
NCBI-ProteinID: XP_019828879
LinkDB All DBs
Position
13
AA seq 791 aa AA seqDB search
MDGHDSPQTPKGSLRKFLEQLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYF
IYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCQDFRTREGRLKAACNLVQLGI
TSLCVIGGDGSLTGAHIFQTEWSGLLEELARDGKISTEQXQKHGHLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKPITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATPETPACVVSLSGNQAVRLPLME
CVQMTQEVQKAMDERRFKDAVRLRGRSFENNLNTYKRLAIKLPDSEIPKSNCNVGVVNVG
APAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQIKEIGWGDVGGWTGQGGSILGT
KRTLPGKYLEDIAAQMRTHGISALLIIGGFEAYLGLLELLAARQKHEEFCVPMVMVPATV
SNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGFCGYLANMGGLAAG
ADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTTDFIYQLYSEEGK
GVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESVGKGKKFLSEDSVCV
LGISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVSFEVSDASQLEPV
QPRGPEEPAAI
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggacggccacgacagcccccagacccccaagggctccctccgaaaattcctggagcaa
ctctccggggccggcaaagccatcggcgtgctgaccagcggcggggatgcccaaggcatg
aatgctgctgtccgggccgtcgtgcgcatggggatatacgtgggggccaaggtgtacttc
atctatgagggctaccagggcatggtggacggtggcagcaacattgtggaagccgactgg
gagagcgtctccagcatcctgcaagtgggaggraccatcattggcagtgcccgctgccag
gacttccgtactcgggaaggccgcctgaaggccgcatgtaacttggttcagctgggcatc
accagcctgtgtgtgatcggcggggacggcagtctcaccggggcccacatcttccagacg
gagtggagcgggctgctggaggagctggcccgcgacggcaagatcagcacggagcaggya
cagaagcacgggcacctcaacgtggtgggratggtgggctccatcgacaaygacttctgc
ggcacggacatgaccatcggcacggactcggccctrcaccgcatcatcgaggtggtggac
gccatcatgacgaccgcccagagccaccagcggaccttcgtcctggaggtgatggggaga
cactgcgggtacctggccctggtgagcgctctggcttgtggggccgactgggtcttcctt
ccygagtccccacctgaggaaggctggcaggaaaacatgtgcatcaagctctcagagaac
cgtgcccggaagaaaaggttgaacatcatcattgtggccgaaggggccatcgacacccag
aacaagcccatcacctcggagcagatcaaggagcttgtggtcacgcagctgggctacgac
acgcgagtgaccatccttggacaygtgcagagaggtgggacrccatcagcctttgacagg
attctggccagccgcatgggggtggaggccgtggtsgccctcctgcaggccactcccgag
accccggcttgcgtggtgtcactgagygggaaccaggcagtgcggctgccgctgatggag
tgtgtacagatgacccaggaggtacaaaargcgatggatgagaggagatttaaggatgcc
gtgcgactccgaggaaggagcttcgagaacaacctcaatacctacaagcggctggccatc
aagctgccggactccgaaatcccaaagagcaactgcaaygtgggcgtcgtgaacgtgggt
gcgcccgcggccggcatgaacgcggccgtgcgygctgccgtgcgcgtgggcatctctgag
ggacacaagatgtttgccgtgtacgacggcttcgagggcttcgccaaaggccagataaag
gaaatyggctggggggacgttggaggctggacgggccaaggcggctccatccttgggaca
aaacgcaccctccctgggaagtacctggaggacatcgcggcgcagatgcgaacccatggc
atcagtgcgctcttgatcatcggtggattcgaggcctacctggggctgctggagctgttg
gccgcccggcagaagcacgaggagttctgtgtccccatggtcatggtccccgccaccgtc
tccaacaacgtgcccggctccgacttcagcatcggggcggataccgccctcaacaccatc
accgayacrtgtgaccgcatcaagcagtcagccagcgggaccaagcggcgcgtgttcatc
attgagaccatggggggcttctgtggctacctggccaacatgggaggactggcggctggc
gcagacgctgcctacatcttcgaggagcccttcgacatccgggacctgcagtccaacgtg
gagcacctgacggagaagatgaagaccagcatccagagggggctggtgctcaggaacgag
agctgcagcgagaactacaccaccgacttcatctaccagctctactccgaggagggcaag
ggcgtgttcgactgcaggaagaatgtgctgggccacatgcagcagggtggggcgccttct
ccgttcgacagaaactttggaaccaaaatttccgccagagccatgcagtggatcagctcg
aagctgagggagtccgtggggaaaggaaaaaaatttttaagtgaggactctgtgtgtgtg
ctgggaatcagcaagagaacactgctgttccagcccgtggcggagctgaagaaggagaca
gacttcgagcaccggatccccaaggagcagtggtggttgaagctgcggcccctcatgaag
atcctggccaagtacaaggtcagcttcgaggtgtcggatgccagccagctggagcctgtg
cagccccgtggccccgaggagccggctgccatctag

DBGET integrated database retrieval system