KEGG   Bos indicus (zebu cattle): 109568172
Entry
109568172         CDS       T04792                                 

Gene name
SCRIB
Definition
(RefSeq) LOW QUALITY PROTEIN: protein scribble homolog
  KO
K16175  protein scribble
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04390  Hippo signaling pathway
biu04530  Tight junction
biu05165  Human papillomavirus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    109568172 (SCRIB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    109568172 (SCRIB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109568172 (SCRIB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    109568172 (SCRIB)
SSDB
Motif
Pfam: PDZ PDZ_6 LRR_8 LRR_4 PDZ_2 LRR_9
Other DBs
NCBI-GeneID: 109568172
NCBI-ProteinID: XP_019828950
UniProt: A0A6P5CTE1
LinkDB
Position
14
AA seq 1676 aa
MVSRSLVLIGSRGGGAGAGQGEHPGSAEAASLVGQRPEYRKEGICGVSRSCLVLWCPHGV
AVNLGGGLPAVRGSTVTCSGGDSSFPTGCARGRYGSSEAPAPQGLAVPEEIYRYSRSLEE
LLLDANQLRELPKPFFRLLNLRKLGLSDNEIQRLPPEVANFMQLVELDVSRNDIPEIPES
IKFCKALEIADFKWEPPXPSSLLRLPEGFTQLRSLAHLALNDVSLQALPGDVGNLANLVT
LELRENLLKSLPASLSFLVKLEQLDLGGNDLEVLPDTLGALPNLRELWLDRNQLSALPPE
LGNLRRLVCLDVSENRLEELPAELGGLVLLTDLLLSQNLLQRLPDGIGQLKQLSILKVDQ
NRLCEVTEAIGDCENLSELILTENLLTALPHSLGKLTKLTNLNVDRNHLEALPPEIGGCV
VFCVLSLXDNRLAVLPPELAHTAELHVLDVAGNRLQSLPFALTHLNLKALWLAENQAQPM
LRFQTEDDAQTGEKVLTCYLLPQQPLPSLEDPELQSSPSESWGDAPLSRVSVIQFLEAPA
GXDDPEEAAAEKRGLQRRATPHPSELKVMKRGVERRSEATSCRPDPAPPSPSEEEKRLST
ESGLSADSHLSAGTVSQGEPEGPLAEEEGLSQQEPMPATQEEVMEETYEEPTVRFAEDTL
LLPREDGENEEGQPEAPWPLPGGRQRLIRKDTPHYKKHFKISKLPQPEAVVALLQGTPPD
NEGPVGTGGWHNGPHMSWAPRAEEEEEEEEDEAEEEEEGEAAAAAEEEKAVASAPSVKGV
SFDQANNLLIEPARIEEEELTLTIVRQTGGLGISIAGGKGSTPYKGDDEGIFISRVSEEG
PAARAGVRVGDKLLEVNGVALQDAEHQQAVEALRGAGATVHMRLWRERMVEPENAVTVTA
LRPEDDYSPRERRGGGLRLPLLPPEPPGPPRQRHVACLVRSEKGLGFSIAGGKGSTPYRA
GDGGIFISRIAEGGAAHRAGTLQVGDRVLSVSVASPPPPTATPATPGEPGPLRLPPSLLA
AALEGPYPVEEICLPRAGGPLGLSIVGGSDHSSHPFGVQEPGVFISKVLPRGLAARSGLR
VGDRILAVNGQDVREATHQEAVSALLRPCLELVLLVRRDPPPPGMRELCIQKAPGERLGI
SIRGGAKGHAGNPCDPTDEGIFISKVSPTGAAGRDGRLRVGLRLLEVNQQSLLGLTHGEA
VQLLRSVGDTLTVLVCDGFDTSAATPEVSPGIIANPFAAGLGRRNSLESISSIDRELSPE
GPGKEKELPGQIPLWGPEASAPQGRSPESLKPACRALAATPGAGSMQRVLPAASGEMAEP
PCSPSHQQPPSPPSPAELPANVKQAYRTFAAVPGLHPPLDTPAQHPMLGPTASPEQLSFR
ERQKYFELEVRVPQAEGPPKRVSLVGADDLRKMQEEEARKLQQKRAQMLREAAANTGLPE
ADAPEDEEPEEEPPWAGQGPMAEGLGPASPPPQGGGAPVRTAKAERRHQERLRVQSPELP
APERALSPAERRALEAEKRALWRAARMKSLEQDALRAQMVLSKSQDGRSKRGPLERLAEA
PSPAPTPSPTPLEDLGPQTGTSPGRLALSGRKFDYRVFAALPSSRPVYDMQSPDFAEELR
SLEPPPSPGLPEEDGEVAMVLLGRPSPSSTGPEEVALCSSRRAXXPGRRGLGPVPS
NT seq 5031 nt   +upstreamnt  +downstreamnt
atggtatctcgtagtcttgtgcttattggctcccggggcgggggtgcgggtgcggggcag
ggcgagcacccaggcagcgcagaggcagcgagccttgtcggtcagagacctgaataccgc
aaggaaggcatttgcggggtcagcaggagttgcttggttctttggtgcccgcacggggtg
gcggtgaaccttgggggtggccttcctgctgtgcggggctctactgtcacatgctcaggg
ggcgactcgagcttcccgacaggctgtgcgcggggccgctacgggtcctcggaggcaccg
gcgccgcagggccttgccgtgcccgaggagatctatcggtacagccgcagcctggaggag
ctgctcctcgacgccaaccagctgcgcgagctccccaagcccttctttaggctactgaac
ctgcgtaagctgggcttgagcgacaacgagatccagcggttgcctccggaggtggccaac
ttcatgcagctggtggagctggatgtgtcccggaacgacatccctgagatccccgagagc
atcaagttctgcaaagctctggagattgctgacttcaagtgggaacccccttgaccctct
tctctccttaggctccccgaaggcttcactcagctacgcagtctggctcacctggcgctg
aatgatgtgtccctgcaggcactgcctggggacgtgggcaacctcgccaacctggtgacc
ctggagctccgggagaatctgctcaagtccctgcctgcgtccctgtctttcctggtcaag
ctggaacagctggatttgggaggcaatgatctggaagtgctgcctgacaccctgggggcc
ctgcccaacctgcgggagctgtggctggaccggaaccagctatcagccctgcccccggag
cttgggaatctgcggcgcctggtgtgcctggatgtgtctgagaaccggctggaggagctg
cccgcggagcttgggggactggtgctgctcactgacctgctgctctcacagaacctgctg
cagcggcttccagacggcattggtcagctgaagcagttgtccatcttgaaggtggaccag
aatcgcctgtgcgaggtgacagaagccatcggggactgtgagaacctgtcggagctgatc
ctcactgagaacctgctgacggccctgccccactccttggggaaactgaccaagctgacc
aacctcaacgtggaccggaaccacctagaggcactgccgcctgagattgggggctgygtg
gtattctgtgtcctctctttgnaggacaaccgcctggccgtcctgccgccagagctcgcc
cacacggctgagctacatgtgctggatgtggccggcaaccgcctgcagagtctgccgttt
gcactcacgcacctcaacctgaaggccttgtggctagcggagaaccaggcgcagcccatg
cttcggttccagaccgaggatgatgcccaaacgggcgagaaggtgctcacctgctacctg
ctgccacagcagcccctgcccagtcttgaggaccctgagctgcagagcagcccttcggaa
agctggggagacgccccgctcagccgtgtcagcgtcatccagttcctggaggcccccgcg
ggckacgacgacccggaggaagccgctgccgagaaacggggcctgcagcgtcgggctacg
ccacaccccagcgagctcaaggtgatgaagaggggtgtggagcgccggagcgaagccacc
tcctgcaggcctgaccctgcgccaccctcgccctccgaggaggagaagaggctgagcact
gagtctggcctgagtgcagactcgcacctgtctgccggcacagtctcccagggcgagcct
gagggcccgctggccgaggaggaggggctgagccagcaggaacccatgccagccacccag
gaagaggtcatggaggagacctacgaggagcccactgtgcgcttcgcggaggacacgctg
ctcctgcccagggaggacggcgagaacgaggagggccagccagaggcaccctggcccctg
ccggggggcagacaaaggctcatccgcaaggacacgccccactacaagaagcacttcaag
atctccaagctgccccagcccgaggccgtggtggccctcctgcaggggacacctccagac
aatgagggcccagtggggactgggggctggcacaatggcccccacatgtcctgggctccg
cgagcggaggaggaggaggaggaggaggaagacgaagctgaggaggaagaggagggggag
gcggcggcagcagcagaggaggagaaggcggtggcctctgcgccctctgtcaagggggtg
tcgtttgaccaggccaataacctgctgatagagcccgctcgcattgaggaggaagagctg
acgctgaccatcgtgcggcagacagggggcctgggcatcagcattgcgggtggcaaggga
tccacgccctacaagggagacgacgagggtattttcatctcccgggtgtctgaggagggc
cctgcggctcgggctggggtccgagtaggtgacaagctcctcgaggtgaacggcgtggcc
ctgcaggacgcggagcaccagcaggccgtggaggcactgcgcggggcgggtgccactgtg
cacatgcggctgtggcgggagcgcatggtggagcctgagaatgcagtcaccgtcacagcc
ctgcggcccgaggacgactacagcccgcgggagcggcgaggaggcggcctgcgcctgcct
ctgctcccgcccgagccacctgggccaccccgccagcgccacgtggcctgtctcgtgcgt
agtgagaaggggctgggtttcagcatcgcaggcgggaaaggctccacgccctaccgggcc
ggtgatgggggcatcttcatctcccgcatcgctgaggggggtgctgcccaccgggcaggc
accctgcaggtcggcgaccgcgtcctttccgtgagtgtggcgtcccccccgccccccact
gctacccctgccaccccaggggagcctgggcctctgaggctgccccctagtctgctggcc
gctgccctggaggggccgtacccagtggaggaaatctgtctgcccagagcggggggcccc
ttggggctcagcatcgttgggggctccgaccactccagccacccattcggtgtccaggag
cccggcgtgttcatttccaaggtgctcccgcggggcctggctgcacgcagtggcctgcgg
gtcggggaccgcatcctggcagtgaatgggcaggatgtgcgggaggccacgcaccaggaa
gcagtcagcgccctgctccggccctgcctggagctggtgctgctcgtgcggagggacccg
ccgcccccgggcatgcgggagctctgcatccagaaggcccccggggagaggctgggcatc
agcatacgtgggggcgccaagggccaygccgggaacccctgcgaccccaccgatgagggc
atcttcatctccaaggtgagccccacgggagcagctgggcgagatggccgtttgcgggtg
ggactgcggctgctggaggtgaaccagcagagcctgctgggtctgacgcatggagaggct
gtgcagctgctgcgcagtgtgggcgacaccctgactgtcctggtctgcgacggcttcgac
accagcgctgccacccccgaggtgtccccaggcatcatcgccaaccccttcgcggccggc
cttggccgccggaacagcctggaaagcatctcctccatcgaccgggagctgagccccgag
ggccccggcaaggagaaggagctgcccggacagatcccactatggggcccagaggcctct
gccccccaggggcggagcccagagagcctgaagccagcctgccgagccctggccgccacc
cctggcgccggcagcatgcagagggtgctgcctgcggcaagtggagagatggctgaaccc
ccctgctcccctagccaccagcagcccccctccccgccctcccctgccgagctgccagcc
aacgtgaagcaggcctataggacgttcgcggctgtgcctggcctgcacccgcccctggac
acccctgcccagcaccccatgctcgggcccacggcctcgccggagcagctgtccttccgc
gagcggcagaagtacttcgagctggaggttcgggtgccccaggccgagggcccccctaag
cgcgtgtcgctggtgggcgctgacgacctgcggaagatgcaggaggaggaggcccgcaag
ctgcagcagaagagggcgcagatgctgcgcgaggcggcggccaacacggggctcccggaa
gccgatgctcccgaggacgaggagcccgaggaggaaccaccctgggccggccagggcccc
atggcagaagggctcggtcccgcgtctcccccgccgcagggaggcggtgccccagtgcgg
actgccaaggccgaaaggcgccaccaggagcggcttcgcgtgcagagccccgagctgccg
gccccagagcgggccttgtcccctgcggagcgccgagccttggaggcggagaagcgggcg
ctctggagggcagccaggatgaagtccctggagcaggatgccctccgcgcacagatggtc
ctcagcaagtcccaggatggccgaagcaagcgggggcccctggagcgcctggccgaggcc
ccctcgccggcacctactccgtcacccacccccttggaagacctcggcccccagaccggc
acctccccgggacgcttggccttgtctgggaggaagtttgactacagggtgtttgccgcc
ctcccctcttccagacctgtctatgacatgcagtccccagatttcgctgaggagctgagg
tccttggaaccacctccgagcccaggtctgccagaggaggacggagaggtggccatggtg
cttctgggcaggccctctccaagctccacgggtcccgaggaggtggccttgtgcagcagc
cgccgggccnnnnggccagggcgccgaggcctgggcccagtgccctcttag

DBGET integrated database retrieval system