KEGG   Bos indicus (zebu cattle): 109568429
Entry
109568429         CDS       T04792                                 

Gene name
PTK2
Definition
(RefSeq) LOW QUALITY PROTEIN: focal adhesion kinase 1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01522  Endocrine resistance
biu04012  ErbB signaling pathway
biu04062  Chemokine signaling pathway
biu04151  PI3K-Akt signaling pathway
biu04360  Axon guidance
biu04370  VEGF signaling pathway
biu04510  Focal adhesion
biu04670  Leukocyte transendothelial migration
biu04810  Regulation of actin cytoskeleton
biu04935  Growth hormone synthesis, secretion and action
biu05100  Bacterial invasion of epithelial cells
biu05135  Yersinia infection
biu05146  Amoebiasis
biu05163  Human cytomegalovirus infection
biu05165  Human papillomavirus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05205  Proteoglycans in cancer
biu05222  Small cell lung cancer
biu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109568429 (PTK2)
   04370 VEGF signaling pathway
    109568429 (PTK2)
   04151 PI3K-Akt signaling pathway
    109568429 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    109568429 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    109568429 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    109568429 (PTK2)
   04062 Chemokine signaling pathway
    109568429 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    109568429 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    109568429 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568429 (PTK2)
   05202 Transcriptional misregulation in cancer
    109568429 (PTK2)
   05205 Proteoglycans in cancer
    109568429 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    109568429 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109568429 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    109568429 (PTK2)
   05100 Bacterial invasion of epithelial cells
    109568429 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109568429 (PTK2)
   05163 Human cytomegalovirus infection
    109568429 (PTK2)
   05165 Human papillomavirus infection
    109568429 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109568429 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109568429 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109568429 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109568429 (PTK2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     109568429 (PTK2)
Protein kinases [BR:biu01001]
 Non-receptor tyrosine kinases
  FAK family
   109568429 (PTK2)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109568429 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M FERM_F2 Kinase-like
Other DBs
NCBI-GeneID: 109568429
NCBI-ProteinID: XP_019829268
UniProt: A0A6P5CUI9
LinkDB
Position
14
AA seq 1114 aa
MLLGVAGRGALEPQALSMEKSGCSPFPVCWAKEYDRYLASSKRMAAAYLDPNLNHTPSSS
TKTHLGTGVERSPGAMERVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKV
KHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQF
TEDKPTLNFFYQQVKSDYMLEIADQVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEVL
EKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKEC
FKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGTLQ
LKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVHGATQSFIIRPQKEGERALPSIPKLA
NSEKQGVRTHAVSVSETDDYAEIIDEEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGE
GQFGDVHQGTYTSPENPALAVAIKTCKNXTSDSVREKFLQEALTMRQFDHPHIVKLIGVI
TENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESKRFVHRDIAAR
NVLVSSNDCVKLGDFGLSRYMEDSTYYKGFTFSNXSSSSKGKLPIKWMAPESIXFRRFTS
ASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWAY
DPSRRPRFTELKAQLSTILEEEKVQQEERMRMESRRQVTASWDSGGSDEAPPKPSRPGYP
SPRSSEGFYPSPQHTVQTNHYQVSGYPGPHGVTAMAGSIYPGQASLLDQTDSWNHRPQEI
SMWQPSVEDSAALDLRGLGQALPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLSR
GSIDREDGGPQGLTGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLGSPGDSYNEG
VKPWRLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSSKIQPAPPEEYVPMVKEVG
LALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKK
QMLTAAHALAVDAKNLLDVIDQARLKALGQPRPH
NT seq 3345 nt   +upstreamnt  +downstreamnt
atgttgttgggagtggcgggccgaggggccctggaaccccaggcgctgtctatggagaag
agcggctgtagtccgtttccagtgtgttgggctaaagaatatgacagatacctagcatct
agcaaaagaatggctgctgcttaccttgacccaaacttgaatcacacgccgagttcaagt
accaagactcacctgggaactggtgtggagcgttctcctggggccatggagcgagtatta
aaggtctttcattattttgaaagcaacagtgagccaaccacttgggccagtattatcagg
catggagatgcaaccgacgtcaggggcatcattcagaagatagtggacagtcacaaagta
aagcacgtggcctgctatggatttcgcctgagtcacctgcggtcagaggaggttcactgg
ctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcccacccacca
gaggagtggaaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagttt
actgaagacaagccaactttgaatttcttctatcaacaggtgaagagcgattatatgtta
gagatcgctgaccaagtggaccaggacattgcactgaagttgggttgtctagaaatacgg
cgatcgtactgggagatgcgcggcaacgccctggaaaagaagtctaactacgaagtgctg
gagaaagatgttggtttgaagcggtttttccctaggagtttactggattcagtcaaggcc
aaaacactaagaaaattgatccaacaaacatttagacagtttgccaaccttaacagggaa
gaaagtattctgaagttctttgagatcctctccccggtgtacagatttgataaagaatgc
ttcaagtgtgcccttggttcaagctggattatttcagtagagctggcgattggccccgag
gaaggaatcagttacctcacagacaagggctgcaatcccacacacctggccgacttcaac
caagtgcagactatccagtattcaaacagtgaagacaaggacaggaaagggacgctgcag
ctgaagatcgcaggggcgcccgagcccctgacggtcacggccccgtccctgaccatcgcc
gagaacatggccgacctgatcgacgggtactgccgcctggtgcacggggccacgcagtcc
ttcatcatccggccccagaaagaaggtgaacgggctttgccatcgataccaaagctggcc
aacagcgagaagcagggcgtgcgcacccatgcggtctccgtgtcagaaacggacgattat
gccgagatcatagatgaagaggacacttacaccatgccctccaaaagctatggaatagat
gaagccagggactacgagattcagagagaaagaatagaactcggccggtgcatcggagag
ggccagtttggagacgtgcaccagggcacctacacgagcccggagaatccagctttggca
gttgcaattaaaacatgtaaaaactrtacttcggacagtgtgagagagaagttccttcaa
gaagccttaacgatgcgtcagtttgaccaccctcacattgtgaagctgatcggagtcatc
acagagaacccggtctggatcatcatggagctgtgcacactcggagagctgcggtcgttt
ctgcaagtaaggaaatacagtttggatctagcgtctttgatcctctatgcctatcagctt
agtacagcccttgcgtatctggagagtaaaagatttgtacacagggacattgctgctcgg
aacgttctggtgtcctcaaatgattgcgtaaaattaggagactttggattatcccgatat
atggaagatagtacttactataaaggttttactttctcaaattawtcttccagctccaaa
ggaaaattgcctattaaatggatggctcctgagtcaatcnawtttcgacgttttacctca
gctagtgacgtgtggatgtttggtgtgtgtatgtgggaaatcctgatgcatggcgtgaag
ccctttcaaggcgtgaagaacaatgacgtgatcgggcgcatcgagaacggggagagactg
cccatgcctcccaactgccctcccactctctacagcctcatgaccaagtgctgggcgtac
gaccccagccggcggccccgcttcactgagctcaaggctcagctcagcacaatcctggag
gaagagaaggtccagcaagaagagcgcatgaggatggagtccagaaggcaggtcaccgcg
tcctgggactctggagggtccgacgaagcgccacccaagcccagcagacctggttacccc
agtccgaggtccagtgaaggattctaccccagcccgcagcacacggtgcagaccaatcac
taccaggtctctggctaccctggcccacatggagtcacagccatggctggcagcatctac
ccaggtcaggcatctctcttggaccaaacagattcgtggaatcacagaccacaggagata
tccatgtggcagcccagcgtggaggactcggcggcgctggacctgcgcggcctcgggcag
gcgctgcccacacacctgatggaggagcggctgatccggcagcagcaggagatggaggag
gaccagcgctggctggagaaggaggagaggtttctgaaacctgacgtgcggctctctcga
ggcagcatcgacagggaggacggaggtcctcagggcctgactggaaaccagcacatatat
cagcctgtgggcaaaccagatcctgcagcaccaccaaagaagccgccgcgtcccggagcc
cccgggcacctgggcagcctggccagcctcggcagccctggggacagttacaacgagggc
gtcaagccatggaggcttcagccccaggagatcagcccccctcccacggccaacctggac
cggtccaacgacagggtgtatgagaacgtgacaggcctggtgagagcggtcatcgagatg
tccagcaagattcagcccgccccgccggaggagtacgtccccatggtgaaggaagtcggc
ctggccctgaggacgctgttggccacggtggatgagaccattcctgttctgcccgccagc
acccaccgagagatcgagatggcccagaagctgctgaactccgacctgggggagctcatc
aacaagatgaaactggcccagcagtacgtcatgaccagcctgcagcaggagtacaagaag
cagatgctgacagccgcgcacgcgctggccgtggacgccaagaacctgctcgacgtcatc
gaccaggccagactgaaggccctggggcagccgaggccgcactga

DBGET integrated database retrieval system