KEGG   Bos indicus (zebu cattle): 109568594
Entry
109568594         CDS       T04792                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04012  ErbB signaling pathway
biu04110  Cell cycle
biu04151  PI3K-Akt signaling pathway
biu04218  Cellular senescence
biu04310  Wnt signaling pathway
biu04350  TGF-beta signaling pathway
biu04390  Hippo signaling pathway
biu04550  Signaling pathways regulating pluripotency of stem cells
biu04630  JAK-STAT signaling pathway
biu04919  Thyroid hormone signaling pathway
biu05132  Salmonella infection
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05163  Human cytomegalovirus infection
biu05166  Human T-cell leukemia virus 1 infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
biu05210  Colorectal cancer
biu05213  Endometrial cancer
biu05216  Thyroid cancer
biu05219  Bladder cancer
biu05220  Chronic myeloid leukemia
biu05221  Acute myeloid leukemia
biu05222  Small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
biu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109568594 (MYC)
   04012 ErbB signaling pathway
    109568594 (MYC)
   04310 Wnt signaling pathway
    109568594 (MYC)
   04350 TGF-beta signaling pathway
    109568594 (MYC)
   04390 Hippo signaling pathway
    109568594 (MYC)
   04630 JAK-STAT signaling pathway
    109568594 (MYC)
   04151 PI3K-Akt signaling pathway
    109568594 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109568594 (MYC)
   04218 Cellular senescence
    109568594 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    109568594 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    109568594 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568594 (MYC)
   05202 Transcriptional misregulation in cancer
    109568594 (MYC)
   05206 MicroRNAs in cancer
    109568594 (MYC)
   05205 Proteoglycans in cancer
    109568594 (MYC)
   05230 Central carbon metabolism in cancer
    109568594 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109568594 (MYC)
   05225 Hepatocellular carcinoma
    109568594 (MYC)
   05226 Gastric cancer
    109568594 (MYC)
   05216 Thyroid cancer
    109568594 (MYC)
   05221 Acute myeloid leukemia
    109568594 (MYC)
   05220 Chronic myeloid leukemia
    109568594 (MYC)
   05219 Bladder cancer
    109568594 (MYC)
   05213 Endometrial cancer
    109568594 (MYC)
   05224 Breast cancer
    109568594 (MYC)
   05222 Small cell lung cancer
    109568594 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109568594 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109568594 (MYC)
   05161 Hepatitis B
    109568594 (MYC)
   05160 Hepatitis C
    109568594 (MYC)
   05163 Human cytomegalovirus infection
    109568594 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109568594 (MYC)
   05169 Epstein-Barr virus infection
    109568594 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:biu03000]
    109568594 (MYC)
   03019 Messenger RNA biogenesis [BR:biu03019]
    109568594 (MYC)
Transcription factors [BR:biu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    109568594 (MYC)
Messenger RNA biogenesis [BR:biu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     109568594 (MYC)
SSDB
Motif
Pfam: Myc_N HLH Myc-LZ
Other DBs
NCBI-GeneID: 109568594
NCBI-ProteinID: XP_019829543
UniProt: A0A6P5CV97
LinkDB
Position
14
AA seq 439 aa
MPLNVSFANKNYDLDYDSVQPYFYCDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETLIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDGGSPSPARGHGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAESSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGSHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEQQKLKSEIDVL
QKRREQLKLKLEQIRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaagaactatgacctcgactacgattcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccaccagcagcagcagagcgaactg
cagccgccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccgtcgtacgtcgcggtcgcctccttc
tcgcccaggggagacgacgacggcggcggcggcagcttctcctcagcggaccagttggag
atggtgaccgagctgctaggaggcgacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccctcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctgcgcgcaaagacggcggc
agcccgagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgaatgcatcgacccctcggtggtcttcccctacccgctcaac
gacagcagctcgcccaagccctgcgcytccccggactccaccgccttttctccgtcctct
gactctctgctctcctctgctgagtcctccccgcgggccagtcccgagcccctggcgctc
catgaggagaccccacccacgaccagtagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctctgccggcagccacagcaaacctcctcacagcccgttagtcctaaagagatgc
cacgtgtctacccatcagcacaattacgcagcgcccccctccactaggaaggactatccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaaccgc
aaatgtgccagcccgaggtcttcggacacggaggagaatgacaagaggcggacacacaac
gttttggagcgccagaggagaaacgagctgaaacgcagcttttttgctcttcgtgaccag
atcccagagttggagaacaatgaaaaagcccccaaggtagttatccttaaaaaagccaca
gcgtacatcctgtcggtccaagcagagcagcaaaagctcaagtcagaaatagacgtgttg
cagaagaggcgagaacagttgaaactcaaacttgaacagatacggaactcttgcgcctaa

DBGET integrated database retrieval system