KEGG   Bos indicus (zebu cattle): 109568650
Entry
109568650         CDS       T04792                                 

Gene name
IL7
Definition
(RefSeq) interleukin-7
  KO
K05431  interleukin 7
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04151  PI3K-Akt signaling pathway
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109568650 (IL7)
   04151 PI3K-Akt signaling pathway
    109568650 (IL7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109568650 (IL7)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109568650 (IL7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568650 (IL7)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  Interleukins
   109568650 (IL7)
Glycosaminoglycan binding proteins [BR:biu00536]
 Heparan sulfate / Heparin
  Cytokines
   109568650 (IL7)
SSDB
Motif
Pfam: IL7
Other DBs
NCBI-GeneID: 109568650
NCBI-ProteinID: XP_019829628
UniProt: A0A6P5CVH0
LinkDB
Position
14
AA seq 176 aa
MFHVSFRYIFGIPPLILVLLPVASSDCDISGKDGGAYQNVLMVNIDDLDNMINFDSNCLN
NEPNFFKKHSCDDNKEASFLNRASRKLRQFLKMNISDDFKLHLSTVSQGTLTLLNCTSKG
KGRKPPSLSEAQPTKNLEENKSSKEQKKQNDLCFLKILLQKIKTCWNKILRGIKEH
NT seq 531 nt   +upstreamnt  +downstreamnt
atgttccatgtttcttttaggtatatctttggaattcctcccctgatccttgttctgttg
ccagtagcatcatctgattgtgatattagcggtaaagacggtggagcatatcagaatgtt
ctaatggtcaacatcgatgacttggacaacatgataaactttgatagcaattgcctgaat
aacgaacctaacttttttaaaaaacattcatgtgatgataataaggaagcttcatttttg
aatcgtgcttctcgaaagttgaggcaattccttaaaatgaatatcagtgacgatttcaag
cttcacctatcaacagtttcacagggcacattaacactgctgaactgcaccagcaagggt
aaaggaagaaaaccaccttccctgagtgaagctcaacccactaagaatttggaagagaat
aaatcttcaaaggaacagaaaaaacagaatgacctgtgtttcctaaagatactactacaa
aagataaaaacttgttggaataaaattttgaggggcattaaagaacactga

DBGET integrated database retrieval system