KEGG   Bos indicus (zebu cattle): 109568669
Entry
109568669         CDS       T04792                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
biu04640  Hematopoietic cell lineage
biu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109568669
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109568669
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109568669
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568669
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:biu04050]
    109568669
   04090 CD molecules [BR:biu04090]
    109568669
Cytokine receptors [BR:biu04050]
 Interleukin receptor families
  IL3 receptor family
   109568669
CD molecules [BR:biu04090]
 Proteins
  109568669
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 109568669
NCBI-ProteinID: XP_019829646
UniProt: A0A6P5CUA1
LinkDB
Position
14
AA seq 362 aa
MVLDSAWLLTQEQQDLPTVKPNASLNVKFDPQTTKLTWDCRENASSGECVLIHKEKGXIK
KKVKDSECQCTFQDYSLHGGVTLTVEVHVNQRRLSEMLVYTNPGREGTAAQNFSCVIYDA
DFMNCSWAKGRAAPDDVQYFLYIRSKKRIERECPRYLKDSGTHVGCHLXDLSGLTSYXYF
LVNGTSQETGIQFFDSVLLLKEIEQYNPPDNITVQCNESHCLIRWEKPRTRQPWPNREFQ
YQLDIQRRRDTSSSRSQLIVVFGDSGNRYNFPKPGSKAKHTVKIRTADARKAHWGAWSQP
VEFXFLKSHRLFPPVPQIKDKLNDNHQVDHEMLWEKFTHETGKSDKEEVLTVETVSEAPA
KL
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggtgcttgactcygcatggctcctcacccaggagcagcaggatcttccaaccgtgaag
ccaaacgccagcctaaatgtgaagtttgacccacagacgacgaagctgacttgggactgc
agggaaaacgctagctctggggaatgtgtgctgattcacaaggagaaggggcygattaag
aaaaaggtcaaagacagtgagtgtcagtgcacgtttcaggactattctctccacggggga
gtcacgcttaccgttgaagtacatgtcaaccagagacggctttcagaaatgctggtctac
actaacccaggtagggagggcacggctgcccaaaacttctcctgtgttatctacgacgcg
gatttcatgaactgcagctgggccaagggccgagcggctcccgacgacgtccagtacttt
ctgtacatccgatcaaagaaaagaatcgagagggaatgtcctcgttacctgaaggactcg
gggacccacgtgggatgtcacctccragacctctcgggattaacgtcgtacarttacttc
ctggttaacggtaccagccaagaaaccggaatccagttcttcgactcggttttgctgtta
aaggaaatagagcagtacaacccacctgacaacatcaccgtccagtgcaacgagtcccac
tgcctcatcaggtgggaaaagcccaggacccgacagccatggcccaacagggagttccag
taccagctggacatccagagacggcgcgataccagcagcagtagaagtcaactgattgta
gtatttggtgactccggtaatagatacaactttccgaaaccgggatccaaagcgaaacat
actgtgaagatcaggacagcggacgcccggaaagcccactggggagcctggagccagccc
gttgagttcngattcctcaagagccacaggttattccctccrgttccacagatcaaagat
aaattgaatgataaccatcaagtcgaccacgagatgctatgggagaagtttacacacgaa
acgggaaaaagtgacaaggaagaggtcttaaccgtggagacagtctcagaagccccagcg
aaactgtga

DBGET integrated database retrieval system