KEGG   Bos indicus (zebu cattle): 109568806
Entry
109568806         CDS       T04792                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04012  ErbB signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu04144  Endocytosis
biu04910  Insulin signaling pathway
biu05100  Bacterial invasion of epithelial cells
biu05200  Pathways in cancer
biu05205  Proteoglycans in cancer
biu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109568806 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    109568806 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109568806 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109568806 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109568806 (CBL)
   05205 Proteoglycans in cancer
    109568806 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109568806 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    109568806 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:biu04131]
    109568806 (CBL)
   04121 Ubiquitin system [BR:biu04121]
    109568806 (CBL)
Enzymes [BR:biu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     109568806 (CBL)
Membrane trafficking [BR:biu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    109568806 (CBL)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    109568806 (CBL)
SSDB
Motif
Pfam: Cbl_N3 Cbl_N2 Prok-RING_4 Cbl_N zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4
Other DBs
NCBI-GeneID: 109568806
NCBI-ProteinID: XP_019829749
UniProt: A0A6P5CX50
LinkDB
Position
15
AA seq 841 aa
MAGNVKKGSGAGGGGGSGGSGGLIGLMKDAFQPHHHHHHHLSPHPPGTVDKKMVEKCWKL
MDKVKGPAEDPREQGRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRITKADAAEFWRKA
FGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSS
LLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGN
ILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCE
MGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVDP
FDPRGSGSLLRQGAEGAPSPNYEDDDDERADDSLFMMKELAGAKVERPPSPFSMAPQASL
PPVPPRLDLLQQRISIPSSASGLGTASKAPSGSLHKDKPLPIPPTLRDLPPPPPPDRPYS
GGAETRPQRRPLPCTPGDCPSRDKLPPVPSGRIGEASWLHRPIPKVPVVAPNPSDPWTGR
ELTNRHSLPFSLPSQMEPRTDTPRLGSTFNLDTSMNMNSSPLAGAECEHPKIKPSASANA
IYSLAARPLPVPKLPPGEQCESEEDTEYMTPSSRPVGLQKPDVKWPPEIAQSSRTCDCDQ
QIDSCTYEAMYNIQSQVAPSVTESGTFGEGNLAAAHANTGPEESENEEDGYDVPKPPVPA
VLARRTLSDISNASSSFGWLSLEGDPPTHFTESAQVPERPPKPFPRRINSERKAGSCQQS
SAAASAAASPQLSSEIESLLSQGYSYQDIQKALVIAHNNIEMAKNILREFVSISSPAHVA
T
NT seq 2526 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaaaaagggctctggggccggaggcggcggcggctccgggggctcc
ggcggcctgatcgggctcatgaaggacgccttccagccgcaccaccaccaccaccaccac
ctcagcccccacccgccggggaccgtggacaagaagatggtggagaagtgctggaagctc
atggacaaggtgaaaggccctgcggaggacccgcgggagcaggggcgaaacctgaccaaa
ctgtccctgatcttcagccacatgctggcagaactaaaaggaatcttcccaagtggactc
tttcaaggagacacgtttcggattactaaagcagatgctgcagaattttggaggaaagct
tttggggaaaagacaatagtcccttggaagagcttcagacaggcccttcatgaagtacat
cccatcagttctgggctggaggccatggctctgaaatccactattgatctgacctgcaat
gattatatttcagtttttgaattcgatatctttacgagactctttcagccgtggtcctct
ttgctcaggaactggaatagccttgctgtaactcatcctggttacatggctttcctgaca
tatgatgaagtgaaagcacgactccagaaattcattcacaaacctggcagttacattttc
cggctgagctgtactcgtctgggtcagtgggctattgggtatgtcactgctgatgggaac
attctccagacaatccctcacaataaacctctcttccaagcgctgattgatggcttcagg
gaaggcttctatttgtttcctgatggacggaatcagaatcccgacctgacaggcttatgt
gaaccaactcctcaagaccacatcaaagtgacccaggagcaatatgaattatactgtgag
atgggctccacattccaactgtgtaaaatatgtgccgagaatgataaagatgtgaagatt
gagccctgtggccacctcatgtgcacatcctgtctaacatcctggcaggaatcagaaggc
cagggctgtcctttctgccgatgtgaaattaaaggtactgagcccattgtggttgatccc
tttgatcctagaggaagtggcagcctgttgaggcaaggagcagagggagctccctcccca
aattatgaggatgatgatgatgaacgagctgatgattctctcttcatgatgaaggaattg
gctggtgccaaggtggaacgacctccttctccattctccatggccccacaagcttccctt
cccccagtgccaccacgacttgaccttctacagcagcgaatatctatcccttcaagtgct
tctggtcttggaactgcttcgaaggctccttctggctctcttcataaggacaaaccatta
ccaatacctcccactcttcgagatcttccaccgccaccccctccagaccgtccgtattct
ggtggagcagaaacccggcctcagagacgccccttgccttgtacaccaggcgactgtcca
tccagagacaaactgccccctgtcccctctggccgcattggagaagcatcatggctgcat
cggccaatccccaaagtaccagtagttgccccaaaccctagtgacccctggacagggaga
gaattaaccaaccggcattcacttccgttttcattgccctcacaaatggaacccagaacc
gatacgcctaggctcggaagcacattcaatctggatacctccatgaatatgaatagcagc
ccattagcaggtgcagagtgtgagcatcccaaaatcaaaccttccgcatctgccaatgcc
atttattctctggctgccagacctcttcctgtgccaaagctgcctcctggggagcagtgt
gaaagtgaggaggacacagagtatatgactccttcctctaggcccgtgggacttcaaaag
ccagacgtgaagtggcctccggagatagcacagagttcacgaacgtgtgactgtgaccag
cagatcgayagctgtacatacgaagccatgtataatattcagtcccaggtggcgccgtct
gtcacagagagtggtacctttggtgaagggaatttggctgcagcccatgccaacactggc
cctgaggagtcagaaaacgaagaggacgggtatgatgtccccaagccacccgtgcctgcg
gtgctggcccgccgcacgctctccgacatctccaacgccagttcctcctttggctggctg
tccctggaaggtgatcccccgacacacttcactgagagtgcccaggttcctgagaggcca
cccaagccgttccctcggagaatcaactctgaacggaaagcaggcagctgtcagcagagc
agtgctgccgcctcggccgctgcctccccgcagctctccagcgagatcgagagcctcctg
agtcagggctactcctatcaggacattcagaaagccttggtcattgcccacaacaacatt
gaaatggccaaaaacatcctccgggaattcgtttctatttcttctccagcccacgttgcc
acctag

DBGET integrated database retrieval system