KEGG   Bos indicus (zebu cattle): 109569300
Entry
109569300         CDS       T04792                                 

Gene name
AOX1
Definition
(RefSeq) aldehyde oxidase
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00280  Valine, leucine and isoleucine degradation
biu00350  Tyrosine metabolism
biu00380  Tryptophan metabolism
biu00750  Vitamin B6 metabolism
biu00760  Nicotinate and nicotinamide metabolism
biu00830  Retinol metabolism
biu00982  Drug metabolism - cytochrome P450
biu01100  Metabolic pathways
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109569300 (AOX1)
   00350 Tyrosine metabolism
    109569300 (AOX1)
   00380 Tryptophan metabolism
    109569300 (AOX1)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    109569300 (AOX1)
   00760 Nicotinate and nicotinamide metabolism
    109569300 (AOX1)
   00830 Retinol metabolism
    109569300 (AOX1)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    109569300 (AOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569300 (AOX1)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     109569300 (AOX1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C CO_deh_flav_C Fer2_2 Fer2
Other DBs
NCBI-GeneID: 109569300
NCBI-ProteinID: XP_019830200
UniProt: A0A6P5CWU6
LinkDB
Position
2
AA seq 1339 aa
MEGGAELLFYVNGRKVTEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYN
PITKKIRHYPANACLTPICSLYGAAVTTVEGIGSTKTRIHPFQERIAKCHGTQCGFCTPG
MVMSLYTLLRNHPEPTLTQLNDALGGNLCRCTGYRPIINACKTFCKTSGCCQSKENGVCC
LDQGINGLPEFEEGNETSLKLFSEEEFLPLDPTQELIFPPELMTMAEKKTQKTRIFGSDR
MTWISPVTLKELLEAKVKYPQAPVVMGNTSVGPDMKFKGIFHPVIISPDRIEELSVVNYT
DNGLTLGAAVSLAEVKDILANVTRKLPEEKTQMYHALLKHLETLAGPQIRNMASLGGHIV
SRHPDSDLNPLLAVGNCTLNLLSKEGRRQIPLNEQFLRKCPSADLKPEEILISVNIPYSR
KWEFVSAFRQAQRQQNALAIVNSGMRVCFGKGDGIIRELSIAYGGVGPTTILANNSCQKL
IGRPWNEEMLDAACRLILDEVSLPGSAPGGRVEFKRTLIVSFLFKFYLEVSQILKGMDPV
HYPGLASKNESALEDLHSRHYWSTLKYQNADPKQLSQDPVGHPIMHLSGIKHATGEAVYC
DDMPVVDRELFLTFVTSSRAHAKIVSIDASAALSLPGVVDILTGEHLPSITTTFDFLTDA
DQLLSTDEVSCVGQLVCAVIADSEVQARRAAQQVKIVYQDLEPVILTIEEAIQNKSFFEP
ERKLEYGNVDEAFKMVDQILEGEIHTGGQEHFYMETQSMLVVPKGEDQEIDVYVSAQFPK
YIQDITASXLKVSANKVMCHVKRIGGAFGGKVTKTGVLVAITAFAANKHGRPVRCILERG
EDILITGGRHPYLGKYKAGFMNDGRILALDVEHYNNAGAFLDESLFVIETGLLKLENAYK
FPNLRCRGWVCRTNLPSNTALRGFGFPQAGLITEACITEVAAKCGLPPEKVRMINMYKEI
DQTPYKQEINTKNLTQCWKECMATSSYTLRKAAVEKFNSENYWKKKGLAMVPLKYPVGLG
SVAACQAAALVHIYLDGSVLVTHGGIEMGQGVHTKMIQVVSRELRIPLSSIHLRGTSTET
IPNTNXSGGSVVADLNGLAVKDACQTLLKRLKPIISKNPKGTWKDWAQAAFNESISLSAT
GYFRGYESNINWETGEGHPFEYFVYGAVCSEVEIDCLTGAHKNIRTDIVMDVGYSINPAL
DVGQIEGAFIQGMGLYTIEELNYSPQGVLYTRGPNQYKIPAICDIPMELHISLLPPSENS
NTLYSSKGLGESGVFLGCSVFFAIHDAIRAARQERGLPGPLRLNSPLTPEKIRMACEDKF
TKMIPRDEPGSYVPWSVPI
NT seq 4020 nt   +upstreamnt  +downstreamnt
atggaagggggcgccgagctgctcttctacgtgaacggccgcaaggtgacagaaaaaaat
gttgatcctgaaacaatgctattgccatatctgaggaaaaagctccgactcacaggaact
aaatatggctgtggagggggaggctgtggtgcctgcacagtgatgatatcacgatataac
cccattaccaagaagataagacattatccagccaacgcctgtctgacgcccatctgttct
ctgtatggggctgccgtcaccacagtagaaggcataggaagcaccaagaccaggattcat
ccttttcaggagaggattgccaagtgtcacggcacgcagtgtggcttctgcacccccggg
atggtgatgtccctgtacacgctgctgaggaaccatccggagcccaccctgactcagcta
aatgatgctcttggtggtaacctgtgtcgttgcactggatacaggcccataatcaatgca
tgcaagactttctgtaaaacttctggctgctgtcaaagtaaagaaaatggggtttgctgt
ttggatcaaggaataaatggattaccagaatttgaggaaggaaatgagacaagtctgaaa
ctcttctcagaagaggagtttctgccattggatccaactcaagagctgatatttcctccc
gagctaatgacaatggctgagaaaaaaacacagaagaccaggatttttggtagtgataga
atgacctggatttccccagtgaccctgaaggaacttctagaagccaaagtcaagtatccc
caggcccctgttgtcatggggaacacctctgtgggccctgacatgaaatttaaaggcatc
tttcacccagttataatttctcctgatagaattgaagaactgagtgttgtaaactataca
gataacgggctgaccttaggtgccgctgtcagcctcgctgaggtgaaagacatcctggct
aatgtgacccggaaactccctgaggagaagacacagatgtaccatgctctcctgaaacat
ttggaaactctggctgggccccagatcaggaatatggcttctttagggggccacatagtg
agcaggcatccagattcagatctgaaccctctcctggctgtgggcaactgtaccctcaac
ctgctgtcaaaagaaggaagacgacagattcctttaaatgagcagtttctcagaaagtgc
ccaagtgccgatcttaagcctgaagaaatcttgatctcagtgaacatcccctattcaagg
aagtgggagtttgtgtcagccttccgacaagcccagcggcaacagaatgcgcttgcaata
gttaattcgggaatgagagtgtgttttggaaaaggagatggcatcatcagagagttatcc
attgcatacggaggcgttggtccaaccaccatccttgcaaataattcctgccagaaactc
attggaaggccctggaatgaagagatgctggatgcagcttgcaggctgattctggatgaa
gtctccctcccaggctcagccccaggtgggagggtggagttcaagaggaccctcattgtc
agcttcctgttcaagttctacctggaagtgtcacagattttgaaggggatggaccctgtt
cactatcctggccttgcaagcaagaatgagagtgctttagaagatcttcattccagacat
tactggagtacattaaagtaccagaatgcagacccaaagcagctttctcaagacccagtt
ggccatcccatcatgcacctgtctggtattaagcacgccacgggcgaagccgtctactgt
gatgacatgcctgtggtggatcgggaactgttcttgacttttgtaacaagttcaagagct
catgctaagattgtgtctatcgatgcctctgcagctctcagcctgcctggggtggtagac
atcctgactggggaacatcttccaagcatcaccaccacctttgactttttaactgacgct
gatcaacttctgtcaacagatgaggtgtcttgtgtgggtcagcttgtctgcgccgtgata
gccgattccgaggtccaggcaaggcgagctgctcagcaagtgaagattgtctaccaagat
ttggagccagtgatcctaaccattgaggaagctatacaaaacaagtccttctttgagcca
gagaggaaactggagtatggaaatgtggatgaagcatttaaaatggtggatcaaattctt
gaaggtgaaatacacacgggaggtcaagaacacttttatatggaaacccagagcatgctg
gttgttcccaaaggagaagatcaagaaatcgatgtctacgtgtctgctcagtttcctaaa
tacatacaggacataactgcttcartcttgaaggtctcagctaacaaagtcatgtgtcac
gtaaagcgtattggtggagcctttgggggaaaggtgacaaaaactggcgtgctggtagcc
atcaccgcatttgctgcaaacaagcatggtcgtccagtccgctgcattctggaacgagga
gaagacatattaataactggaggccgccacccttaccttggaaagtataaagctggattc
atgaatgatggcagaatcttggccctggatgtggagcattataacaatgcaggtgccttc
ctggatgagtcattatttgtaatagagacgggacttctgaaactggaaaatgcctacaag
tttcccaacctgcgctgccgggggtgggtgtgcagaaccaaccttccatccaacacagct
ttgcgagggtttggctttccccaggcagggctgatcaccgaagcctgtatcacagaagtg
gcagccaaatgtgggttgccccctgagaaggtccgaatgataaacatgtataaggaaatt
gatcaaacaccctacaaacaggagattaayaccaagaacctgacccagtgttggaaagaa
tgcatggccacgtcttcctacaccctaaggaaagcagcggtggagaaattcaactcggag
aattactggaagaagaaggggctggcaatggtccccctgaagtatcctgttggccttgga
tcagttgctgcttgtcaggctgctgccctggttcacatttatctggatgggtctgtgctg
gtgactcacggtggaattgaaatggggcagggggtccacactaaaatgattcaggtggtg
agtcgtgagttaaggataccactgtccagtatccacctccggggaacaagcacagaaacc
atccctaatacaaatscctctggaggttccgtagtggctgatctcaacgggttggcagta
aaggatgcttgtcagactcttctgaaacgccttaaacccatcatcagcaagaatcccaaa
ggcacttggaaagattgggcacaggctgcctttaatgaaagcattagtctctcagctact
ggatacttcaggggttatgagtcgaacataaactgggagacaggcgaaggccaccctttc
gaatactttgtttatggagcagtctgttccgaggttgagatagactgcctgacaggtgct
cataagaacatcagaacagacattgtcatggatgttggctacagtataaatccagccctt
gacgtaggccagattgaaggtgcgtttattcaaggcatgggactttatacaatagaggaa
ctgaattattctcctcaaggtgtcctgtacacccggggcccgaaccagtataaaatccct
gccatctgtgacatccccatggagctgcacatttctttgttgcctccctctgaaaactcg
aataccctgtattcgtctaagggtctgggagagtctggggtattcctggggtgctcagtg
tttttcgccatccacgatgcaataagggcagcacgacaggagagaggcctgcctggacca
ctgaggctcaacagcccactgactccagagaagattagaatggcctgtgaagacaagttc
acaaaaatgattccaagagatgaacctggatcgtatgttccttggagtgtacccatatga

KEGG   Bos indicus (zebu cattle): 109569310
Entry
109569310         CDS       T04792                                 

Definition
(RefSeq) aldehyde oxidase 4-like
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00280  Valine, leucine and isoleucine degradation
biu00350  Tyrosine metabolism
biu00380  Tryptophan metabolism
biu00750  Vitamin B6 metabolism
biu00760  Nicotinate and nicotinamide metabolism
biu00830  Retinol metabolism
biu00982  Drug metabolism - cytochrome P450
biu01100  Metabolic pathways
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109569310
   00350 Tyrosine metabolism
    109569310
   00380 Tryptophan metabolism
    109569310
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    109569310
   00760 Nicotinate and nicotinamide metabolism
    109569310
   00830 Retinol metabolism
    109569310
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    109569310
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569310
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     109569310
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 CO_deh_flav_C Fer2_2 Ald_Xan_dh_C Fer2
Other DBs
NCBI-GeneID: 109569310
NCBI-ProteinID: XP_019830210
UniProt: A0A6P5CWV8
LinkDB
Position
2
AA seq 1335 aa
MPSLSNSDELIFFVNGRKVIEKNADPEVYLLFYLRKILHLTGTKYSCGSGGCGACTVMVS
RYDPKTKKIHHYPVTACLVPICSLHGAAVTTVEGVGSIKTRIHPVQERLAKCHGTQCGFC
SPGMVMSIYTLLRNHPEPTPEQITEALGGNLCRCTGYRPIVESGKTFCAESTVCQMKGSG
KCCMDQEEKSFTSRQEKMCTKLYNEDEFQPFDPTQEPIFPPELIRMAEDPNKRRLTFRGK
RTTWITPVXLNDLLELKTSFPEAPIIMGNTAVGPSIKFRDEFHPVFISPLGLQELYFVDS
TDDGVTIGAGYSLAQLNDALRFIVSEQPKEKTKTYHALLKHLRTLAGAQIRNMATLGGHV
VSRPNYSDLNPILAAGNATINLISKEGKRQIPLDGRFLEKSPEANLKSEETVLSVYIPHS
TQWHFVSGLRIAQRQENAFAIVNAGMSVKFEDGTDTIKELQMFYGSVGPTVVSASKTCQQ
LIGRKWNDQMLSDACRLVLDEIYIPPDAEGGMVEYRRTLIISLLFKFYLKVRRGLNKMDP
HKFPDIPEKFVSALEDFPIETPQGIQMFQCVDPHQPPQDPVGHPVMHQSAIKHTTGEAVF
VDDMPPISQELFLAVVTSTRAHAKIILIDTSAALALPGVVDVITAEDVPGDNSYQGEIFY
AQNEVICVGQIXCTVAADTYAHAKEAAKKVRIVYEDLEPRIITIEQALEHNSFLSAEKKI
EQGDVEQAFKYVDQIIEGKVHVEGQEHFYMETQTILAIPQEEDKEMVLHLGTQFQTHVQE
YVAAALXIPRNRIACHTKRAGGAFGGKVSKPALLGAVSAVAAKKTGRPIRFILERGDDML
ITAGRHPLLGKYKIGFMNNGVIKAADIEYYINGGCSPDESELVMEFMVLRSENAYYIPNF
RCRGRPCKTNLPSNTAFRGFGFPQGIVVGEAYITAVASQCDLTPEQVKEINMYKRTXRTA
HKQTFNPEPLRRCWXECLEKSSFSARKLAAEEFNKKNYWKKRGLAAVPMKFTVGMPTAFY
NQAAALVHIYLDGSVLVSHSGCELGQGLHTKMIQVASRELNIPESYIHLSETNTTTVSNA
TFTAGSMGXDINGKAVQNACQILKARLEPVIRKNPRGTWEXWISEAYKESISLSTTGYFK
GYQTNMDWKKGEGNAFPYFVYGASCSEVEVDCLTGAHKLLRTDIFMDAAFSINPAVDIGQ
IEGAFVQGMGFYTIEELKYSPEGVLYSRGPDDYKIPTVTEIPEEFNVTLVHSQNPIAIYS
SKGLGEAGMFLGSSVLFAIYDAVAAARRERGLTKTFTLSSPATPELIRMTCVDQFTDMIP
RDDPSTFTPWSIHVS
NT seq 4008 nt   +upstreamnt  +downstreamnt
atgccttctctttccaattctgatgagttgattttttttgtgaatggaagaaaggtcata
gagaagaatgctgatcctgaagtatatctactattctacttgaggaaaatcctccacctc
accggcaccaaatacagctgtgggagcggaggctgcggtgcctgcactgtcatggtgtcc
agatacgacccaaagaccaagaagatccaccattatccagttacagcgtgcctggtgccc
atctgctctctgcatggggctgctgtcaccactgtggaaggtgtaggaagcatcaaaacy
aggattcaccccgtgcaggaaagacttgccaagtgtcatgggacacagtgtggcttctgc
agcccaggaatggtgatgtccatctacacgctgctgaggaaccacccggagcccacccct
gagcagataaccgaagctcttggaggtaatttgtgccgctgtactggataccgaccaatt
gtagaaagtggaaaaactttctgtgcggaatcaactgtttgtcaaatgaaaggatcagga
aaatgttgcatggatcaagaagagaagtctttcacaagtagacaggaaaaaatgtgtacc
aarctgtacaacgaagatgaattccagcccttcgatccaacccaggaacctatattccct
cctgaactgataagaatggcagaagacccgaacaaaaggaggctgacgttccgagggaag
aggaccacctggatcactcctgtaaamttgaatgaccttctggagctgaaaaccagtttc
cctgaagcccccatcatcatggggaacactgcagtgggacccagyattaaattcagagat
gaattccatccggtttttatatctccacttgggcttcaagaactatatttcgtggatagc
acagatgatggggtgacgataggcgcaggatacagcctggcccagttgaatgatgcctta
cgttttattgtttctgaacaaccaaaggagaagaccaagacctaccacgctctcctgaag
cacctgagaacacttgctggagcccagattaggaacatggcgactttaggcgggcatgtg
gtgagcaggcctaactattctgacctgaatcccatcttagcagcaggaaatgctaccatc
aatctgatatctaaagaaggaaaacggcagattcctttagatggccgtttccttgagaag
tcacctgaagccaacctcaagtcagaagagactgtgttatctgtgtatattccgcactct
actcagtggcactttgtgtcaggactccggatagcccagcgtcaggagaacgcctttgcc
attgtcaatgctgggatgagcgtgaagtttgaggatggcacagacaccatcaaggaactt
cagatgttctacggaagtgttggccccactgttgtstctgcaagcaaaacctgccagcag
ctcattgggaggaaatggaacgaccagatgctgagtgatgcttgccgattggttctggat
gagatttacatccctccagacgctgaaggtggcatggtagagtataggcgaaccctcatc
atcagcttactcttcaaattctacctcaaagtgaggcgagggctgaacaaaatggacccc
cacaagtttcctgatatyccagaaaagttcgtgagtgcgctagaagatttccctatagaa
acaccccaaggcattcagatgttccagtgcgtggatccccaccaacccccacaagatcca
gttggccacccagtcatgcaccagtcagccattaaacacaccacaggggaagctgtgttt
gttgatgacatgccccccatctcccaagaactcttcctggctgtagtcaccagcaccaga
gctcatgcaaagataatattaattgatacttcagcagccctggcccttcctggtgttgtt
gatgtgataacagcagaggatgttccaggagataatagctatcagggagagattttctac
gcacaaaatgaggtaatttgcgtgggtcagatcrtctgcactgtggctgctgatacctat
gctcatgcaaaagaagctgctaaaaaagtgaggattgtttatgaagacctagagcccagg
attataacaatagagcaagccctagagcacaattcatttctttctgctgagaaaaaaatt
gagcaaggagatgtagagcaagcctttaaatatgttgaccaaatcattgaaggtaaggtc
catgtggaaggacaggaacatttttacatggaaacacaaactatcctggctatcccccaa
gaggaagataaagaaatggtgctacaccttgggacacagtttcagacccatgtgcaggaa
tatgtggctgcagcactaarcatcccaaggaacagaatcgcctgtcacacgaaaagagct
ggaggagcattcggggggaaagtgagcaagcctgctctgctaggagctgtcagtgccgtg
gctgccaaaaagactggccgcccaatacggttcattctggaacgtggtgatgacatgttg
ataactgctggccgccacccactgctcggaaaatacaaaattggattcatgaacaatggt
gtgatcaaagctgctgatattgaatattatatcaatggcggatgcagtcctgatgagtct
gagttggtgatggagttcatggtgctgagaagtgaaaatgcatattatattcctaatttc
cggtgtcggggtagaccttgcaaaacaaatttgccatccaacactgctttccgaggattt
ggcttcccccagggcatagtggtcggtgaagcttatataactgctgtggcttctcagtgt
gacttaacccctgaacaggttaaagaaataaacatgtataagagaactrgcagaacagcc
cataagcagacatttaatcctgagcccttgagaagatgctggraagaatgtctggagaaa
tcttccttctctgctaggaaactggctgccgaggaatttaacaaaaagaactactggaag
aagagggggcttgctgcggtccccatgaaatttacagttgggatgcccacagccttctac
aatcaggctgctgctcttgtccacatctatctcgatggctccgtcttggtgagtcacagt
ggctgtgaactaggacaaggtcttcacaccaaaatgatccaggtggcgagtcgtgaactg
aacatccctgagtcgtatatacacctgtctgagacgaacactaccacggtttccaatgcr
accttcacagctggctcaatggggrcagacatcaacgggaaggctgtgcagaatgcctgc
caaattcttaaggcccgtcttgagccagtcatcaggaaaaaccccaggggaacgtgggag
gygtggatttcagaagcctacaaagaatccatcagtctctccactactggatatttcaaa
ggctaccagacaaatatggactggaagaagggggaaggtaacgctttcccatattttgtt
tatggagcatcctgttccgaggttgaagtcgactgtctcacaggggctcataagctcctt
aggactgacatcttcatggatgctgctttcagcataaacccagctgtggacattggacag
attgaaggagcatttgtccaaggcatgggattctataccatagaagagctgaaatactct
ccagaaggcgtgctttactctcgaggtccagatgactacaaaatccccaccgtcactgaa
atacctgaagagttcaatgtcactttggtgcattcccaaaatcccatcgccatctactcg
tccaaggggttaggtgaggctggaatgttcctgggatcctccgtgttgttcgccatatat
gatgccgtggctgctgcccgcagagagagggggctgaccaagactttcaccctgagtagc
ccagcaacccctgaattgattagaatgacttgtgtggatcagttcactgacatgattccc
agagatgatccatcaacatttacaccttggtccatccatgtgtcttaa

KEGG   Bos indicus (zebu cattle): 109569328
Entry
109569328         CDS       T04792                                 

Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  aldehyde oxidase [EC:1.2.3.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00280  Valine, leucine and isoleucine degradation
biu00350  Tyrosine metabolism
biu00380  Tryptophan metabolism
biu00750  Vitamin B6 metabolism
biu00760  Nicotinate and nicotinamide metabolism
biu00830  Retinol metabolism
biu00982  Drug metabolism - cytochrome P450
biu01100  Metabolic pathways
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109569328
   00350 Tyrosine metabolism
    109569328
   00380 Tryptophan metabolism
    109569328
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    109569328
   00760 Nicotinate and nicotinamide metabolism
    109569328
   00830 Retinol metabolism
    109569328
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    109569328
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569328
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     109569328
SSDB
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Other DBs
NCBI-GeneID: 109569328
NCBI-ProteinID: XP_019830229
UniProt: A0A6P5CYK0
LinkDB
Position
2
AA seq 1339 aa
MPCPSRSDELVFFVNGRKVIERNADPEVTLLSFLRKNLRLTGTKYACGRGGCGACTVMVS
KRDPTSQEIRHFSVTACLVPICSLYGAAVTTVEGVGSMKTRLHPVQERIAKSHGTQCGFC
TPGMVMSMYTLLRNHPQPSEEQLLEALGGNXCRCTGYRPILASGKTFCLESNGCQQKGTG
KCCLDLGENDSSSLGRKSDICTELFVKEEFQPLDPTQELIFPPELLRMTENPEKXTLTFH
GERVTWISPGTFKDLLELKAKHPEAPLILGNTSLGPAMRSKGCLXPILLSPARISELNVV
SKTNDGLTIGAGCSLAQVKDILAERVSELPEEKTQTYRALLKHLKSLASQQIRNMASLGG
HIISRHSYSDLNPILAVGNATLNLTSEEGTRRIPLSEHFLAGLASADLKPEEILESVYIP
HSQKWEFVSAFRQAQCQQNALPDVNAGMRVLFKEGTDIIEDLSITYGGVGAATVSAHKSC
QQLLGRQWDELMLDEACRRLLDEVSLPGWAPGGRVEFKRTLVVSFFFKFYLQVLQELKKL
IKPRRYPEISDRFLSALEDFPGTVPQGVQRYQSVDSHQPLQDPVGRPVMHLSGLKHATGE
AEFCDDIPMVDKELCMALVTSTRAYAKIISIDLSEALEIPGVVDVITAKDIPGTNGTEDD
KLLAVDEVLCVGQIICAVVAETDVQAKRAIEKIKITYEELEPIIFTIKDAIKHNSFLCPE
KKLEQGNIEEAFEKVDQIVEGEVHVGGQEHFYMETQRVLVIPKTEDKELDIYVSTQDPAH
VQKTVSSTLNIPINRITCHVKRVGGGFGGKIGRPAVFGAIAAVGALKTGHPIRLVLDRED
DMLITGGRHPLFGKYKVGFMNNGRIKALDIECFINGGCTLDDSELVTEFLILKLENAYKI
RNLRFRGRACLTNLPSNTAFRGFGFPQGTLVTESCITAVAAKCGLPPEKVREKNMYRTVD
KTIYKQAFNPESLIRCWNECLDASSFHNRRKQVEEFNKKNYWKKRGIAVIPMKFSVGFAA
TSYHQAAALVHIYTDGSVLVTHGGNELGQGIHTKMLQVASRELKIPMSHLHICETSTAMV
PNTIATAASVGADINGKAVQNACQILLKRLEPIIKKNPEGTWEEWIEAAFEQRISLSATG
YFRGYKAFMDWEKGEGDPFPYYVYGAACSEVEIDCLTGAHKKIRTDIIMDACCSLNPAID
IGQIEGAFIQGMGLYTTEELKYSPEGVLYSRGPDEYKIPTISDVPEEFNVSLLPSSQTPL
TIYSSKGLGESGMFLGSSVFFAITDAVAAARKERDIAEDFTVKSPATPEWVRMACADRFT
EMIPRDDPKTFKPWSITVA
NT seq 4020 nt   +upstreamnt  +downstreamnt
atgccttgcccrtcgagatcggatgagctggttttctttgtgaacgggaggaaggtgatt
gaaaggaatgcagacccagaagtcactctcttgagcttcctaagaaagaacttgcgcctc
accggaaccaagtacgcctgcggaagaggaggctgcggtgcctgcaccgtgatggtgtct
aagcgagaccccacgtcccaggagataagacacttctctgtcaccgcctgcctggtgccc
atctgctctctgtatggggctgctgtcaccactgtggaaggtgttggaagcatgaaaacc
aggcttcaccccgtgcaggagaggattgccaagagccacggtacccagtgcggcttctgc
acccctgggatggtgatgtccatgtacacgctgctgaggaaccacccacagccctctgag
gagcaactgctggaagccctggggggtaaccygtgccgctgcactgggtatcggccaatt
ctcgcaagygggaagaccttttgtttggagtcaaatggctgtcaacagaaaggaacagga
aaatgctgcctggatctgggagaaaatgattcttcctcgcttggcaggaaaagtgacatt
tgcacagagttatttgtgaaagaggagttccagcccttggaccctacccaggagctcata
tttcccccggaactcttgagaatgacagagaacccagaaaaacsaaccctgacctttcac
ggagagagggttacttggatctcccctgggaccttcaaagacctcctggagctgaaagca
aaacacccagaagccccgctcatcctgggcaacacatcactrggmcctgccatgagatct
aaaggatgtttgyacccaattctcctctctcctgctaggatttctgagctgaatgtggtg
tctaaaacaaatgatggactgacaataggtgctggctgcagtctggcccaggtcaaggac
atcttggctgagagggtctccgagctcccggaggagaagacccagacgtaccgagcgctg
ctgaagcacctgaagagtctggccagccagcagatccggaacatggcttctttagggggt
catattataagccgacatagctactcagatctgaacccaattctggctgtgggcaacgct
accctcaatctgacatcagaagaaggcacacggcggattcctctaagtgaacattttctt
gctgggttggcaagtgcagacctgaagccggaagaaattttggagtctgtgtatattcct
cactctcaaaagtgggaattcgtgtcagccttccgacaggctcagtgccagcaaaacgcc
ttgcccgacgtgaatgccggcatgcgagtcctcttcaaagagggcacagacatcatcgag
gacctgagcatcacctatggaggggtcggggctgccacagtcagtgcacataagtcctgc
cagcagctcctagggaggcagtgggatgagctgatgctggatgaagcttgcaggcggctc
ctggacgaagtctccctcccaggctgggctccaggtgggagggtggaattcaagaggact
ctggtagtcagcttcttcttcaagttctacctacaagttctgcaggaactgaagaagctc
ataaagccccgccgttatcctgaaatttcagaccgattcctgagcgctctagaagacttc
ccgggcacggttccccagggagtccaaaggtaccagagtgtggattctcaccagcccctc
caagatccagtcggacgccctgtcatgcacctatcgggtctcaaacacgccaccggggag
gccgagttttgtgatgacatccccatggtggataaagaactctgcatggctttagtgacc
agtaccagagcctatgcaaaaatcatatcaattgatttgtccgaggcccttgaaatacct
ggggtggttgatgtgataacagcgaaggacattccaggcaccaatggcaccgaagatgac
aaactgttggccgtagatgaggtactctgcgtgggccagatcatctgtgctgtggttgca
gaaacagatgtacaggcaaaacgtgctattgaaaagataaagataacttatgaagagctg
gagcccataatcttcaccatcaaggatgccataaaacacaactcattcctgtgccctgaa
aaaaaacttgaacaaggaaacatcgaggaggcatttgaaaaagttgatcaaattgttgaa
ggagaggtccatgtcggaggacaggagcatttttacatggaaacacagagagtgcttgtt
attccaaagacagaggacaaagaactggacatttatgtgtcaacacaggatccagcccac
gtgcagaaaacagtgtcctccactttaaacatccccatcaacaggatcacctgtcatgta
aagcgagtgggtggaggttttggcgggaagataggaagaccggctgtcttcggggctatt
gcagctgtgggtgctctcaaaactggtcaccccatccgtcttgttcttgatcgtgaagat
gatatgttaataactgggggaagacacccattatttggaaaatataaagtgggattcatg
aacaacgggcgaatcaaagctctagacatcgagtgcttcattaacggagggtgcacgttg
gatgactcagagctggtaacagaatttcttatcttgaagctggaaaatgcatataaaatc
cgcaacctcaggttccggggccgtgcatgcctgacaaatttaccatccaacacggccttt
cgaggatttggcttcccccaaggaaccctggtaacagaatcatgcatcacagctgtggca
gccaaatgtggccttccgccagaaaaggtaagggagaaaaacatgtaccgaacagttgat
aaaaccatctacaaacaagcrttcaaccctgagagcctgataagatgttggaacgaatgt
ctggacgcgtcttcctttcacaacagaagaaagcaagtggaagagttcaataagaagaac
tactggaagaaaagaggcattgcggtgattcccatgaaattttcagtcggctttgctgca
acaagctatcatcaggcagctgcgctggttcatatttacactgacgggtctgtattggtc
acacatggaggcaacgaactgggacaaggtattcacaccaaaatgctgcaggtggccagc
cgtgaattaaaaatacccatgtctcacttgcacatctgtgaaacaagtaccgccatggtg
cctaatacaatcgctacagcagcatccgtcggagcagatatcaatggcaaagccgtgcag
aatgcttgtcagatccttctgaaacgccttgagcccatcattaagaaaaatccagaaggt
acctgggaagaatggatagaagctgcttttgaacaaagaatcagtctttcagctactgga
tacttcaggggctacaaggccttcatggactgggagaagggagagggagaccctttcccc
tactatgtctatggagctgcctgttctgaggttgaaattgactgcctgacaggagctcac
aaaaaaatcagaacggacatcatcatggatgcctgctgcagtctaaatccggccatcgat
attgggcagattgaaggtgcgtttattcagggaatgggcctttataccactgaagagctg
aaatattccccagaaggtgtcctgtactctcgaggcccagatgagtacaaaattccaacc
atcagcgatgtcccagaggaatttaatgtctccttgttgccatcatcacaaactccacta
accatctattcatccaagggcctgggggagtctgggatgttcctggggtcatccgtgttc
tttgccatcactgatgctgtggctgcagctcgcaaagaaagagacatagctgaggacttc
acagtgaagagcccagcgactccagaatgggttcgaatggcctgtgcagatcggttcaca
gaaatgatcccaagagatgatcctaagacatttaaaccctggtctatcacmgtagcataa

DBGET integrated database retrieval system