KEGG   Bos indicus (zebu cattle): 109569521
Entry
109569521         CDS       T04792                                 

Gene name
CASP8
Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu01524  Platinum drug resistance
biu04115  p53 signaling pathway
biu04210  Apoptosis
biu04215  Apoptosis - multiple species
biu04217  Necroptosis
biu04620  Toll-like receptor signaling pathway
biu04621  NOD-like receptor signaling pathway
biu04622  RIG-I-like receptor signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04657  IL-17 signaling pathway
biu04668  TNF signaling pathway
biu04932  Non-alcoholic fatty liver disease
biu05010  Alzheimer disease
biu05016  Huntington disease
biu05022  Pathways of neurodegeneration - multiple diseases
biu05132  Salmonella infection
biu05134  Legionellosis
biu05142  Chagas disease
biu05145  Toxoplasmosis
biu05152  Tuberculosis
biu05160  Hepatitis C
biu05161  Hepatitis B
biu05162  Measles
biu05163  Human cytomegalovirus infection
biu05164  Influenza A
biu05165  Human papillomavirus infection
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05168  Herpes simplex virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05200  Pathways in cancer
biu05203  Viral carcinogenesis
biu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    109569521 (CASP8)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109569521 (CASP8)
   04215 Apoptosis - multiple species
    109569521 (CASP8)
   04217 Necroptosis
    109569521 (CASP8)
   04115 p53 signaling pathway
    109569521 (CASP8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    109569521 (CASP8)
   04621 NOD-like receptor signaling pathway
    109569521 (CASP8)
   04622 RIG-I-like receptor signaling pathway
    109569521 (CASP8)
   04625 C-type lectin receptor signaling pathway
    109569521 (CASP8)
   04657 IL-17 signaling pathway
    109569521 (CASP8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569521 (CASP8)
   05203 Viral carcinogenesis
    109569521 (CASP8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109569521 (CASP8)
   05016 Huntington disease
    109569521 (CASP8)
   05022 Pathways of neurodegeneration - multiple diseases
    109569521 (CASP8)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    109569521 (CASP8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    109569521 (CASP8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109569521 (CASP8)
   05134 Legionellosis
    109569521 (CASP8)
   05152 Tuberculosis
    109569521 (CASP8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    109569521 (CASP8)
   05161 Hepatitis B
    109569521 (CASP8)
   05160 Hepatitis C
    109569521 (CASP8)
   05164 Influenza A
    109569521 (CASP8)
   05162 Measles
    109569521 (CASP8)
   05168 Herpes simplex virus 1 infection
    109569521 (CASP8)
   05163 Human cytomegalovirus infection
    109569521 (CASP8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109569521 (CASP8)
   05169 Epstein-Barr virus infection
    109569521 (CASP8)
   05165 Human papillomavirus infection
    109569521 (CASP8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    109569521 (CASP8)
   05142 Chagas disease
    109569521 (CASP8)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109569521 (CASP8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:biu01002]
    109569521 (CASP8)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     109569521 (CASP8)
Peptidases and inhibitors [BR:biu01002]
 Cysteine peptidases
  Family C14: caspase family
   109569521 (CASP8)
SSDB
Motif
Pfam: Peptidase_C14 DED
Other DBs
NCBI-GeneID: 109569521
NCBI-ProteinID: XP_019830504
UniProt: A0A6P5CWZ3
LinkDB
Position
2
AA seq 485 aa
MALTQCLYNIGEQLGSDDLAALKFLSRDHIPYRKQEPIKDALMLFQRLQEKRMLEENNLS
FLKELLFRVNRLDLLLNYLYTSEEEMKRELQIPGRAQISAYRILLFQISEDVNKVELKDF
KFFLSQEIAKCKLDDDMTLLDIFVEMEKRTILGEENLDTLKRICEQVNKSLLKKIYDYEE
LRKERRMSLERDPYAFSNDMSQSLPEEGYSKMPAMSDSPEQDSELQTSDTVYRMTSKPRG
YCLIFNNYDFSIARKQVPELHDLKDRTGTDFDADALDKTFRELHFEIVHYKDLTAKGICE
VLESYQKKDHKNKDCFICCILTHGNKGIIYGSDGQEASIYELTSYFTGLKCPSLIGKPKI
FFIQACQGDKYQKGVAVETDSEQMEAYLEVDSSPQKRYIPDEADFLLGMATVKNYVSYRN
IWNGAWYIQSLCQNLRERCPRGEDILTILTKVNFEVSKLDDKQRMAKQMPQPTFTLRKKL
FFPLN
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcgctcacccaatgtctctataatattggggagcagctgggcagtgacgacctggct
gccctcaagttcctaagccgggaccacatcccatataggaagcaggaacccatcaaggat
gccttgatgctattccagaggctccaagaaaagagaatgttggaggaaaacaatctgtcc
ttcttgaaggagctgcttttccgagtgaatagactggatctgctgcttaactacttgtat
accagcgaggaggagatgaagagggagcttcagatacccggcagggcccagatctctgcc
tacaggattctgcttttccagatttcagaagatgtgaacaaagtagaattgaaggacttt
aagttttttttgagccaggagattgccaaatgtaagctggatgatgacatgactttgctt
gatattttcgtggagatggagaagaggaccatcctaggggaagagaacttggacaccctg
aaaagaatctgtgagcaggtcaacaagagcttgctgaagaaaatctatgattatgaagaa
ttaagaaaagagagaagaatgagccttgaaagagatccatatgcattttcaaatgatatg
tcacaatcgcttccagaggagggctactctaagatgccggccatgtcagactctccagaa
caggacagtgagttgcagacatctgacacagtttaccgaatgacaagcaaacctcgggga
tactgtttgatctttaacaattatgattttagcatagcacggaagcaggtgcctgaactt
cacgaccttaaggataggactggaacagactttgatgcagacgctttggataagaccttt
cgtgaacttcattttgagatagtgcactacaaagacctaacagcaaagggaatctgtgag
gttctagaatcctaccagaagaaggaccacaaaaacaaagactgcttcatctgctgcatc
ctcacccacggaaacaagggcatcatctatggctcygatgggcaagaagcctccatctat
gagctgacctcttacttcactggcttaaagtgcccttcccttattggcaaacccaaaatc
ttttttattcaggcttgccaaggggacaagtaccagaaaggtgtagcygttgagaccgac
tcagaacagatggaagcctatttagaggtggactcatcacctcagaagagatatatccca
gatgaggctgactttctgctggggatggccactgtgaaaaactatgtttcctaccgaaac
atctggaatggggcctggtatatccagtcactttgccagaatctgagagaaagatgtcct
aggggtgaagacattctgaccatcctaaccaaggtgaacttcgaagtaagcaaactggat
gacaagcaacgtatggccaaacagatgccacaacctactttcacactgcgaaaaaaactc
ttctttcctcttaattga

DBGET integrated database retrieval system