KEGG   Bos indicus (zebu cattle): 109569541
Entry
109569541         CDS       T04792                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu03420  Nucleotide excision repair
biu04115  p53 signaling pathway
biu04120  Ubiquitin mediated proteolysis
biu05161  Hepatitis B
biu05169  Epstein-Barr virus infection
biu05200  Pathways in cancer
biu05202  Transcriptional misregulation in cancer
biu05210  Colorectal cancer
biu05212  Pancreatic cancer
biu05213  Endometrial cancer
biu05214  Glioma
biu05216  Thyroid cancer
biu05217  Basal cell carcinoma
biu05218  Melanoma
biu05220  Chronic myeloid leukemia
biu05222  Small cell lung cancer
biu05223  Non-small cell lung cancer
biu05224  Breast cancer
biu05225  Hepatocellular carcinoma
biu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109569541 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    109569541 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    109569541 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109569541 (DDB2)
   05202 Transcriptional misregulation in cancer
    109569541 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    109569541 (DDB2)
   05212 Pancreatic cancer
    109569541 (DDB2)
   05225 Hepatocellular carcinoma
    109569541 (DDB2)
   05226 Gastric cancer
    109569541 (DDB2)
   05214 Glioma
    109569541 (DDB2)
   05216 Thyroid cancer
    109569541 (DDB2)
   05220 Chronic myeloid leukemia
    109569541 (DDB2)
   05217 Basal cell carcinoma
    109569541 (DDB2)
   05218 Melanoma
    109569541 (DDB2)
   05213 Endometrial cancer
    109569541 (DDB2)
   05224 Breast cancer
    109569541 (DDB2)
   05222 Small cell lung cancer
    109569541 (DDB2)
   05223 Non-small cell lung cancer
    109569541 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    109569541 (DDB2)
   05169 Epstein-Barr virus infection
    109569541 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:biu04121]
    109569541 (DDB2)
   03400 DNA repair and recombination proteins [BR:biu03400]
    109569541 (DDB2)
Ubiquitin system [BR:biu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     109569541 (DDB2)
DNA repair and recombination proteins [BR:biu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      109569541 (DDB2)
SSDB
Motif
Pfam: WD40
Other DBs
NCBI-GeneID: 109569541
NCBI-ProteinID: XP_019830553
UniProt: A0A6P5CZJ2
LinkDB
Position
15
AA seq 443 aa
MAPRKRPENQKTPEVVVRPKSKRNRSPRELEPEAKKLCVKGPGSSRRFDSGLWAGLASLR
VPPLCSSIVRALHQHKLGTAAWPSLQQGLQQSFLNSLASYRIFQKAAPFDRRATSLAWHP
THPSTLAVGSKGGDILLWNFGIKDKPTFIKGIGAGGSITGMKFNPLNTNQFFTSSMEGTT
RLQDFKGNTLRVFASSDTCNVWFCSLDVSVKSRVVVTGDNVGHVILLNMDGRELWNLRMH
KKKVTHVALNPCCDWLLATASVDQTVKIWDLRQVRGKSSFLHSLPHRHPVNAAHFSPDGA
QLLTTDQKSEIRVYSACQWDCPPSLIPHPHRHFQHLTPIKASWHPRYNLIVVGRYPDPNF
KSCSPHELRTIDVFDGSSGKIMYQLYDPESSGIMSVRPGPSNNKWEEAGIEPHGSKMTNY
SSHALLLLPPLPPHAHPLVSAAQ
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggctcccaggaaacgcccagaaaaccagaagacccctgaggtggttgtgcgccccaag
agcaagaggaacagaagcccccgggagctggagcccgaggccaagaagctctgtgtgaag
ggccccggttctagcagaagatttgactcaggcctttgggcggggttggctagcctgcgg
gtcccgccgctatgcagcagcatcgtcagggccctccaccagcataagctgggcacagct
gcctggccatcactacagcagggtctccagcagtcttttctgaactctctggcttcttac
cggatattccaaaaggctgccccttttgacaggagggccacatccctggcgtggcaccca
actcaccccagcaccctggctgtgggctccaaagggggagatatcttgctctggaacttt
ggcataaaggacaaacctaccttcattaaagggattggagctggagggagcatcactggg
atgaagtttaaccctctcaataccaaccagtttttcacctcctcaatggagggaacgact
aggctgcaagattttaaaggcaacactctccgagtttttgccagctcagacacctgcaac
gtctggttctgcagcttggacgtatctgtcaaaagccgagtggtggtcacgggagacaat
gtggggcacgtgatcctgctgaacatggatggcagggagctttggaatctgagaatgcac
aaaaagaaggtgacccatgtggccctgaacccgtgctgtgactggctcctggccacagcc
tccgtagatcaaacggtgaaaatctgggacctgcgccaggttagagggaaatccagcttc
ctccactcgctgccgcacaggcatcctgtcaacgcagctcacttcagtcccgatggagcc
cagctcctgactactgaccagaaaagtgagatccgggtttactctgcttgccagtgggac
tgcccgccaagcctgatcccacatcctcaccgccacttccagcacctgacacccatcaag
gcaagctggcatcctcggtacaacctcattgtcgtgggccgatacccagatcctaatttc
aaaagttgttccccccatgaattaaggacgatcgatgtgtttgatggaagctcaggaaag
atcatgtatcagctgtatgacccagaatcttctggtatcatgtcggtgaggcctgggccc
tcaaataataaatgggaggaggcagggattgaacctcatggatcaaaaatgaccaattac
tcctcacatgcccttcttctgctacctccactccctcctcatgctcatccccttgtctct
gcagctcaatga

DBGET integrated database retrieval system