KEGG   Bos indicus (zebu cattle): 109569574
Entry
109569574         CDS       T04792                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor isoform X1
  KO
K05420  ciliary neurotrophic factor
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04060  Cytokine-cytokine receptor interaction
biu04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    109569574 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    109569574 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:biu04052]
    109569574 (CNTF)
Cytokines and growth factors [BR:biu04052]
 Cytokines
  CSF and other factors
   109569574 (CNTF)
SSDB
Motif
Pfam: CNTF FGase
Other DBs
NCBI-GeneID: 109569574
NCBI-ProteinID: XP_019830627
UniProt: A0A6P5D0Q2
LinkDB
Position
15
AA seq 199 aa
MAFAEHSLLPPHRRDLCSRSIWLARKIRSDLTALVDSYMKHQGLNGNMNLDTLEGVPTAS
SSRWSELTEAERLQENLQAYRAFHGMLARLLEDQRAHFTPAEEDFHQAIHAVLLQVAAFT
YQLEELMVLLEHRVPPREAGGPPLLPGDAGLFEKKLWGLKVLQELSRWTVRSVHDLRTIS
RQSGVPACGSRCATKDKRM
NT seq 600 nt   +upstreamnt  +downstreamnt
atggctttcgcggagcattcgctgctcccccctcaccgccgggacctgtgtagccgctcc
atctggctagcacggaagatccgttcagacctgactgctctggtggactcttacatgaag
catcagggtctgaacgggaacatgaacctggacactctggaaggcgtgccgacggccagc
tccagcaggtggagcgagctgactgaggcggagcggctccaagagaacctccaggcctac
cgcgccttccacgggatgttggcccggctgttggaagaccagcgggcacacttcaccccg
gccgaagaagacttccaccaggcgatacacgctgtcctcctccaggtggcggccttcacg
taccagctggaggagttgatggtgctgctggagcacagggtgccccccagggaggccggc
gggccgcccctcctccctggggacgctggtctctttgagaagaagctgtggggcctgaag
gtgctgcaggagctttctcggtggacggtgaggtccgtgcatgacctgaggaccatctct
cgacaaagtggggtccccgcatgtgggagccgttgtgccaccaaggacaagagaatgtag

DBGET integrated database retrieval system