KEGG   Bos indicus (zebu cattle): 109569730
Entry
109569730         CDS       T04792                                 

Gene name
CD44
Definition
(RefSeq) CD44 antigen isoform X1
  KO
K06256  CD44 antigen
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04512  ECM-receptor interaction
biu04640  Hematopoietic cell lineage
biu05169  Epstein-Barr virus infection
biu05205  Proteoglycans in cancer
biu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    109569730 (CD44)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569730 (CD44)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    109569730 (CD44)
   05205 Proteoglycans in cancer
    109569730 (CD44)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    109569730 (CD44)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:biu04147]
    109569730 (CD44)
   04090 CD molecules [BR:biu04090]
    109569730 (CD44)
   00535 Proteoglycans [BR:biu00535]
    109569730 (CD44)
   00536 Glycosaminoglycan binding proteins [BR:biu00536]
    109569730 (CD44)
Exosome [BR:biu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109569730 (CD44)
  Exosomal proteins of other body fluids (saliva and urine)
   109569730 (CD44)
  Exosomal proteins of colorectal cancer cells
   109569730 (CD44)
  Exosomal proteins of bladder cancer cells
   109569730 (CD44)
CD molecules [BR:biu04090]
 Proteins
  109569730 (CD44)
Proteoglycans [BR:biu00535]
 Cell surface proteoglycans
  Others
   109569730 (CD44)
Glycosaminoglycan binding proteins [BR:biu00536]
 Hyaluronan
  Cell surface receptors
   109569730 (CD44)
SSDB
Motif
Pfam: Xlink
Other DBs
NCBI-GeneID: 109569730
NCBI-ProteinID: XP_019830956
UniProt: A0A6P5CY90
LinkDB
Position
15
AA seq 703 aa
MDTFWWRAAWGLCLVQLSLAQIDLNITCRYAGVFHVEKNGRYSISKTEAADLCKAFNSTL
PTMAQMEAARNIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFN
ASAPPGEDCTSVTDLPNAFEGPITITIVNRDGTRYTKKGEYRTNPEDINPSVVSPSSPPD
DEMSSGSPSERSTSGGYSIFHTHLPTVHPSPDQDGPWVSSEPENTSDTSTDSSIISAGWE
PTEENEDERDRHPSYSGSGIGDDEDFISSTISTTPRVFTHPQENQNWIQRNPDHSNPEAS
LQXTTRMTDVDRSSTSAYGESWTQEPHSSRSHRGYHDEEETPHSTSTTQAPTTSTAEETA
TQKEQWFESGRPGEFPHTPKEDSXSTAGTTVTTASTHVSHPHQRVTTQSQEDSSWTYVFD
PVSHPMGRGHQTKXRMDTSPSTTLQPSADPNMSSVGDLDRTGPLSMTTQQSDTHSFSPSH
GGLEEDQGHSTTAAPTSINRNDGRRGGNLPEDATASMEGYTHSPDTNEYTTLTPVTPTKT
GSPGVTEVTIVGDSTSKADLTLPGDYGSSRDPSGRSYTTHASESAGHSSGSEEHGANTTS
GPMRKPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINNGNGTMEERKPSGL
NGEASKSQEMVHLVNKGSSETQDQFMTADETRNLQNVDMKIGV
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggacacgttttggtggcgcgcagcctggggactctgcctcgtgcagctgagcctggcg
cagatcgatctgaatataacctgccgatatgcaggtgtattccacgtggagaagaatggt
cgctatagcatctctaagactgaggctgccgacctctgcaaggcctttaatagcacgctg
cccaccatggcccagatggaggcggcccggaacatagggtttgagacctgcaggtacggg
ttcatagaagggcatgtggtgattccccggatccaccccaattccatctgtgctgcraac
aacacgggggtgtacatcctcacatccaacacctcccagtatgacacgtactgcttcaat
gcctcagctccacctggggaagactgtacatcggtcacggacctgcccaatgcctttgaa
ggaccaattaccataactattgtaaaccgtgatggcacccgttataccaagaaaggcgaa
tacagaactaacccagaagacatcaaccccagcgtcgttagccccagcagccctcctgac
gatgagatgagcagcggctcccccagtgagagaagcacttcaggaggctacagcatcttc
cacacgcacctcccaactgtgcacccgtccccagaccaagacggcccctgggtctccagc
gagccagagaatacctcggataccagtacggattcaagtatcatctcagcaggctgggag
ccaactgaagaaaatgaagatgaaagagacagacaccccagttattctggatcaggcatt
ggtgatgatgaagattttatctccagcaccatttctaccacaccacgggtttttacccac
ccacaagagaaccagaattggatccaaaggaacccagaccattcgaatccagaagcatca
cttcagayaaccacaaggatgactgatgtggacagaagtagtaccagtgcttacggagaa
agctggacccaggaaccacactcctctcgcagtcaccgtgggtatcatgatgaagaggag
accccgcattctacaagcacaacccaggcacccactactagtacagcagaagaaacagct
acccagaaagagcagtggtttgagagtggaaggcctggggaatttccccacacaccaaaa
gaagactctsattcaacagcagggacaactgtcacaacagcctcgacgcacgtcagccat
cctcatcaaagagtaacaacgcagagccaagaggacagttcctggacttatgtcttcgac
ccagtctcgcatccaatggggcgaggtcatcaaacaaaargaaggatggacaccagccct
agtacaacgcttcaaccttctgcagatccaaacatgagttccgtgggagacttggacagg
acaggacctctctcaatgacaactcagcagagtgatactcacagcttctctccatcgcat
ggcggcttagaagaagaccaaggccactcaacgactgctgctccaacatctatcaatagg
aacgatggcagaagaggtggaaatcttcctgaagatgcaactgcttcaatggaaggttac
actcattctccagacacaaatgaatacacaaccctcaccccagtgacccctactaagact
gggtcccctggagttactgaagttactattgttggagattccacctctaaggctgatctt
actttaccaggagactacggctcgtcccgcgaccccagtggaagatcctatacaactcac
gcatctgaatcagctggacactcaagtgggagtgaagaacatggggcaaacacaacctca
ggtcctatgcggaaacctcaaattccagaatggctgatcatcttggcatctctcctggcc
ttggctttgattctcgcggtttgcattgctgtcaacagtaggagaaggtgtgggcagaag
aaaaaactggtgatcaacaatgggaatggaaccatggaggagagaaagcccagcggactc
aatggagaagctagcaagtctcaggagatggtgcatttggtgaacaaggggtcgtcagag
acccaagaccagttcatgacggcagatgagacgcggaacttgcagaatgtggatatgaag
attggggtgtaa

DBGET integrated database retrieval system