KEGG   Bos indicus (zebu cattle): 109569940
Entry
109569940         CDS       T04792                                 

Gene name
CD3E
Definition
(RefSeq) T-cell surface glycoprotein CD3 epsilon chain
  KO
K06451  T-cell surface glycoprotein CD3 epsilon chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu05142  Chagas disease
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569940 (CD3E)
   04660 T cell receptor signaling pathway
    109569940 (CD3E)
   04658 Th1 and Th2 cell differentiation
    109569940 (CD3E)
   04659 Th17 cell differentiation
    109569940 (CD3E)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109569940 (CD3E)
  09163 Immune disease
   05340 Primary immunodeficiency
    109569940 (CD3E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109569940 (CD3E)
   05170 Human immunodeficiency virus 1 infection
    109569940 (CD3E)
   05162 Measles
    109569940 (CD3E)
   05169 Epstein-Barr virus infection
    109569940 (CD3E)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109569940 (CD3E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569940 (CD3E)
CD molecules [BR:biu04090]
 Proteins
  109569940 (CD3E)
SSDB
Motif
Pfam: Ig_5 Ig_4 ITAM Ig_2 Ig_3 ig
Other DBs
NCBI-GeneID: 109569940
NCBI-ProteinID: XP_019831302
UniProt: A0A6P5D2R1
LinkDB
Position
15
AA seq 186 aa
WRALGLCLLLVGAWAQDADEQKPYEVSISGNTVELTCPREFEGEIHWKQNDEQMKGYTGK
QLLLENFSEMDNSGYYQCYMTEGNKEAAHTLYLKARVCQNCMEVNLMEVATIIVVDICVT
LGLLLLVYYWSKSRKAKASPMTRGAGAGGRPRGQNKGRPPPVPNPDYEPIRKGQRDLYAG
LNQRGV
NT seq 562 nt   +upstreamnt  +downstreamnt
ctggcgagctctgggactctgcctcttattagttggtgcttgggcacaagatgctgatga
acagaaaccatatgaagtctccatctctggaaacactgttgagctgacatgccctagaga
gtttgaaggtgaaatacattggaaacaaaatgatgaacaaatgaaaggctatactgggaa
acagctgttactggaaaacttttcagaaatggataacagtggttattatcagtgctacat
gaccgaaggcaacaaggaggccgcacacacgctgtacctgaaagcaagagtgtgtcagaa
ctgcatggaggtgaatctgatggaggtggccacaatcatcgtggttgacatctgtgtcac
tctgggcttgctgctgctggtgtattactggagcaagagccgaaaggccaaagcctcgcc
tatgacgagaggagcgggtgctggcggtaggcctcggggacaaaacaaggggaggccacc
ccctgtacccaatccagactatgagcccatccggaaaggccagcgggacctgtatgctgg
cctgaatcagagaggcgtctga

KEGG   Bos indicus (zebu cattle): 109569960
Entry
109569960         CDS       T04792                                 

Gene name
CD3D
Definition
(RefSeq) T-cell surface glycoprotein CD3 delta chain
  KO
K06450  T-cell surface glycoprotein CD3 delta chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu05142  Chagas disease
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
biu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569960 (CD3D)
   04660 T cell receptor signaling pathway
    109569960 (CD3D)
   04658 Th1 and Th2 cell differentiation
    109569960 (CD3D)
   04659 Th17 cell differentiation
    109569960 (CD3D)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109569960 (CD3D)
  09163 Immune disease
   05340 Primary immunodeficiency
    109569960 (CD3D)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109569960 (CD3D)
   05170 Human immunodeficiency virus 1 infection
    109569960 (CD3D)
   05162 Measles
    109569960 (CD3D)
   05169 Epstein-Barr virus infection
    109569960 (CD3D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109569960 (CD3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569960 (CD3D)
CD molecules [BR:biu04090]
 Proteins
  109569960 (CD3D)
SSDB
Motif
Pfam: Ig_4 ITAM Ig_5
Other DBs
NCBI-GeneID: 109569960
NCBI-ProteinID: XP_019831329
UniProt: A0A6P5D1T3
LinkDB
Position
15
AA seq 168 aa
MEHSRFLSCLILAALLSQVNPRILKVLEPEDKVMLECNSSITLLQGTEGQEVSGNNKTRD
LGKRIQDPRGMYQCGENTQQLILQVYYRMXQNCVELDTATLAGMIITDIIATVLLALGVY
CFAGHETGRFSRAADTQALMGNDQLYQPLRERNDAQYSRLGDKWARNK
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagcacagcaggtttctctcttgcctgatactggctgcccttctctcccaagtgaat
ccccgcattctaaaagtgctggaacctgaggacaaagtaatgttggaatgcaattccagc
atcacattgctacaaggaacagaaggacaagaggtgtcaggcaataataaaactcgggac
ttaggaaaacgtatccaggacccaagaggaatgtatcagtgtggtgaaaacacccaacaa
cttattctgcaagtatactatcgaatgtrccagaactgtgtggagctggacacagccacc
ctggcaggcatgatcatcaccgacatcattgccactgtgctccttgctttgggtgtctac
tgctttgctggacatgagactggaagattctccagggctgctgacactcaagctctgatg
gggaatgaccaactctatcagccccttcgagagcgcaatgatgctcagtacagtcgtctt
ggtgataagtgggctcggaacaaatga

KEGG   Bos indicus (zebu cattle): 109569992
Entry
109569992         CDS       T04792                                 

Gene name
CD3G
Definition
(RefSeq) T-cell surface glycoprotein CD3 gamma chain
  KO
K06452  T-cell surface glycoprotein CD3 gamma chain
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
biu04658  Th1 and Th2 cell differentiation
biu04659  Th17 cell differentiation
biu04660  T cell receptor signaling pathway
biu05142  Chagas disease
biu05162  Measles
biu05166  Human T-cell leukemia virus 1 infection
biu05169  Epstein-Barr virus infection
biu05170  Human immunodeficiency virus 1 infection
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569992 (CD3G)
   04660 T cell receptor signaling pathway
    109569992 (CD3G)
   04658 Th1 and Th2 cell differentiation
    109569992 (CD3G)
   04659 Th17 cell differentiation
    109569992 (CD3G)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109569992 (CD3G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    109569992 (CD3G)
   05170 Human immunodeficiency virus 1 infection
    109569992 (CD3G)
   05162 Measles
    109569992 (CD3G)
   05169 Epstein-Barr virus infection
    109569992 (CD3G)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    109569992 (CD3G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:biu04090]
    109569992 (CD3G)
CD molecules [BR:biu04090]
 Proteins
  109569992 (CD3G)
SSDB
Motif
Pfam: Ig_4 Ig_5 ITAM Ig_3 ig
Other DBs
NCBI-GeneID: 109569992
NCBI-ProteinID: XP_019831384
UniProt: A0A6P5D1Y2
LinkDB
Position
15
AA seq 175 aa
MDMEQGKXLAGLILAVFLLQGTMAHVKEVKVDDNREDGSVILICVTNDTTITWLKDVEQI
GSGDTKKNTWNLGSSTKDPRGIYKCEGSNNQSKSLQIYYRMCQNCIELNPSTVAGFIFTE
IVSIFLLAVGVYFIAGQEGVRQSRASDKQTLLNNDQLYQPLKEREDDQYSHLRKN
NT seq 528 nt   +upstreamnt  +downstreamnt
atggatatggagcaggggaagcrtctggctggcctcatcctggctgtctttcttcttcaa
ggtactatggcccatgtgaaagaagtaaaagtggatgacaatcgagaagatggttccgta
attctgatttgtgtcacgaatgacacaacgatcacatggcttaaagatgtggaacaaata
ggttctggagacacaaagaaaaatacttggaatcttggaagtagtaccaaagaccctcga
ggaatatataaatgtgaaggatcaaataaccaatcaaaatcactccaaatatattataga
atgtgtcagaactgcattgaactgaatccrtctactgtggctggctttatcttcactgaa
atcgtcagcattttcctccttgctgttggggtctatttcattgctggacaggaaggagtt
cgccagtcaagagcttcagacaagcagacgctgttgaacaatgaccagctctaccagccc
cttaaggaacgggaagatgaccaatacagccacctgaggaagaactga

DBGET integrated database retrieval system