KEGG   Bos indicus (zebu cattle): 109569985
Entry
109569985         CDS       T04792                                 

Gene name
MS4A1
Definition
(RefSeq) B-lymphocyte antigen CD20
  KO
K06466  B-lymphocyte antigen CD20
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:biu00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    109569985 (MS4A1)
Transporters [BR:biu02000]
 Other transporters
  Pores ion channels [TC:1]
   109569985 (MS4A1)
CD molecules [BR:biu04090]
 Proteins
  109569985 (MS4A1)
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 109569985
NCBI-ProteinID: XP_019831376
UniProt: A0A6P5CZE2
LinkDB
Position
15
AA seq 303 aa
MTTPRNSMVGAFPAEPLKGPIAMHAAQKVVPRRVPVVVGPTQSFFMREAKALGAVQIMNG
LFHIALGSLMLIHMDVYMPICVTLWYPLWGGIMFIISGSLLAAAEKNSTQSMLTGRLIMN
SLSLFAAISGIIFLIMDIFNMTISHFFKMENLNLIKTQVPYININNCERANPDENNSQSV
EYCARIRFVFLSNFAVMMIFAFLQKLVTAGTVENEWKKLCSRPKANVVLLSAEEKKEQAI
EIKEEVVEQIEVAEQIEISSLPKNEEDIEIIPVQEEEEEEAEMNFPEPPQDQEDSPIEND
SVP
NT seq 912 nt   +upstreamnt  +downstreamnt
atgacgacacccaggaattcaatggttggagccttcccagcagagcctctgaaaggtccc
attgccatgcatgctgctcagaaagtggttcccaggagggtgcctgtggtggtgggcccc
acacagagcttcttcatgagggaagcgaaggctctgggggctgtccagatcatgaacggg
ctgttccacattgccctgggcagcctcatgctgatccacatggacgtctacatgcccatc
tgtgtaaccytgtggtaccctctctggggaggcatcatgttcatcatttctggatcactg
ctggcagcagcggagaagaactccacacagagcatgcttacaggaagactaataatgaac
tctttgagcctctttgctgctatttctggaataatttttttgatcatggacatatttaat
atgacaatttcccacttttttaaaatggagaatctgaaccttattaagactcaggtgccg
tatattaacatcaacaactgtgagcgagctaaccctgatgagaataactctcagtccgtg
gaatattgtgccaggatacggtttgtgttcctgagcaatttcgcagtgatgatgatcttt
gcattcctccagaaacttgtgacagctggcactgttgagaatgaatggaaaaaactatgc
tccagacccaaagctaacgttgttctcctgtcagctgaagaaaaaaaggagcaggcgatc
gaaataaaagaagaagtggttgagcagattgaagtggctgagcagattgaaatatcttcc
ctaccaaagaatgaagaagacattgagattattccagtccaagaagaagaggaagaagaa
gcagaaatgaactttccagagcccccccaagatcaggaagactcgccaatagagaacgac
agtgtcccttaa

DBGET integrated database retrieval system