KEGG   Bos indicus (zebu cattle): 109570101
Entry
109570101         CDS       T04792                                 

Gene name
MAPKAPK2
Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04010  MAPK signaling pathway
biu04218  Cellular senescence
biu04370  VEGF signaling pathway
biu04625  C-type lectin receptor signaling pathway
biu04722  Neurotrophin signaling pathway
biu05167  Kaposi sarcoma-associated herpesvirus infection
biu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109570101 (MAPKAPK2)
   04370 VEGF signaling pathway
    109570101 (MAPKAPK2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    109570101 (MAPKAPK2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570101 (MAPKAPK2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570101 (MAPKAPK2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    109570101 (MAPKAPK2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    109570101 (MAPKAPK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:biu01001]
    109570101 (MAPKAPK2)
Enzymes [BR:biu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109570101 (MAPKAPK2)
Protein kinases [BR:biu01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   109570101 (MAPKAPK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like Choline_kinase
Other DBs
NCBI-GeneID: 109570101
NCBI-ProteinID: XP_019831462
UniProt: A0A6P5D396
LinkDB
Position
16
AA seq 466 aa
MGIFLVCPXEINTIRHCRSEHGILPKVKMLTKLTAEKDRVPVLGPAPPTRPHRPALPPPP
PGPAPSALPFKARPRTQTRPPAPCPGPPPALCLGPSPPPAPAQPPPPQFPQFHVRSSLQI
KKNAIIDDYKVTTQVLGLGINGKVLQIFSKRTQEKFALKMLQDCPKARREVELHWRASQC
PHIVRIVDVYENLYAGRKCLLIVMECLDGGELFSRIQDRGDQAFTEREASEIMKSIGEAI
QYLHSINIAHRDVKPENLLYTSKRPNAILKLTDFGFAKETTSHNSLTTPCYTPYYVAPEV
LGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKSRIRMGQYEFPNPEWSEV
SEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKE
EMTSALATMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAALAH
NT seq 1401 nt   +upstreamnt  +downstreamnt
atgggcatcttccttgtgtgccccrgggagatcaacaccatccgccactgcaggtctgag
catggcatcttgcccaaagtcaagatgctcactaaattaactgccgagaaagatcgagta
ccggtgttagggccagccccgcccacacgcccacaccgcccggccctacccccaccacct
cctggtcccgccccctcggccctcccctttaaggcccggccccggacgcagacgcggcct
cccgcgccgtgccccggcccgccgcccgcgctgtgcctcggtccgtcgccgccccccgcc
ccggcgcagccgccgccgccgcagttcccccagttccacgtcaggtcgagcctgcagatc
aagaagaacgccatcatcgacgactacaaggtcaccacgcaggtcctggggctgggcatc
aacggcaaagttctgcagatcttcagcaagaggacacaggagaaattcgccctaaaaatg
ctgcaggactgccccaaggcccgccgcgaggtggagctgcactggcgcgcctcgcagtgc
ccgcacatcgtgcgcatcgtggacgtctacgagaacctgtacgcggggcggaagtgcctg
ctgatcgtcatggagtgtttggatggcggagaactgttcagtcgaatccaggaccgagga
gaccaggccttcacggaaagagaggcctcagagatcatgaagagcattggcgaggccatc
cagtatttgcactcaatcaacatcgcccatcgggatgtcaagcccgagaaccttttatac
acctccaaaaggcccaatgccattctcaaactcactgattttggctttgccaaggaaacc
accagtcacaactctctgaccactccttgttacacgccatactacgtggctccagaggtg
ctgggcccagagaagtacgacaagtcctgtgacatgtggtccttgggtgtcatcatgtac
atcctgctgtgtgggtacccccccttctattccaaccatggccttgccatctctccgggc
atgaagagtcgcatccgaatgggccagtatgaattccccaacccagaatggtcagaagta
tcagaggaagtgaagatgctcatccggaacctgctgaagaccgagcccacccagaggatg
accatcaccgagttcatgaaccacccctggatcatgcaatcgacgaaggtccctcaaacc
ccactgcacaccagccgggtcctgaaggaggacaaggagaggtgggaggacgtcaaggag
gagatgaccagtgccttggccacgatgcgggtcgactaygagcagatcaagataaaaaag
attgaagacgcgtccaaccctctgcttctgaagaggcggaagaaagcccgggccctggag
gccgcggccctcgctcactga

DBGET integrated database retrieval system