KEGG   Bos indicus (zebu cattle): 109570168
Entry
109570168         CDS       T04792                                 

Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11-like
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04072  Phospholipase D signaling pathway
biu04360  Axon guidance
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04931  Insulin resistance
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
biu05211  Renal cell carcinoma
biu05220  Chronic myeloid leukemia
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109570168
   04630 JAK-STAT signaling pathway
    109570168
   04072 Phospholipase D signaling pathway
    109570168
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570168
   04650 Natural killer cell mediated cytotoxicity
    109570168
   04670 Leukocyte transendothelial migration
    109570168
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109570168
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570168
  09158 Development and regeneration
   04360 Axon guidance
    109570168
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109570168
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109570168
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109570168
   05211 Renal cell carcinoma
    109570168
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109570168
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109570168
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109570168
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109570168
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    109570168
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc PTPlike_phytase Y_phosphatase3
Other DBs
NCBI-GeneID: 109570168
NCBI-ProteinID: XP_019831518
UniProt: A0A6P5D0F4
LinkDB
Position
16
AA seq 540 aa
MTSRRWFHPNISGVEAEQLLMSSGQHGSFLARPSKSCPGGFTLSVRRHNEVTHIKIQNTG
DYYDLYGGEKFATLAELVQHYTGQHGGLLRERGGAPVELRHPLGCQDPTSERWYHGHLSG
KEAEKLLMEKGRPGSFLVRESQSKPGDFVLSVLTQQLDRVDRQPRVTHIMIHFQPDGKYD
VGGGEQFDTLGDLVERYRKNPMVERSGVVVHLRQPLKATRISAASIESRVQELSEATDAS
EKAKQGFWEEFEMLQQQECRLLYPRKEGQRPENKPKNRYKNILPFDTTRVILHDVDDRVP
GADYINANYIRSDPEEKPGHGLGKVYIATQGCLPTTVAAFWAMVHQENTHVIVMTTREVE
RGRNKCFRYWPELHGSQEYGHLHVCNMAEHWAQGYCVRELQVWRPDQEESPHTVKHYQYF
SWPDHGVPAEPTGVLSFLEEVNRTHSSMPGAGPMVVHCSAGIGRTGTIIVIDILVDVIRR
QGLDCDIDVPKTIQLVRRQRSGMVQTEAQYKFVYLALQRYIPRTREAPRHEYENLQGLEP
NT seq 1623 nt   +upstreamnt  +downstreamnt
atgacctcgcgcaggtggtttcaccccaacatcagtggagttgaggctgagcagctactc
atgtccagtggccagcacggaagcttcctggcaagacccagcaagagctgccccgggggc
ttcacactgtctgtcaggcgccataatgaggtgactcacatcaagatccagaacacaggt
gactactacgatctgtatggaggggagaagttcgcgacgctggctgagctggtacagcac
tacacaggccagcatggggggctgctccgagagcgtggcggggcccccgtggagctccgg
cacccgctgggctgccaggaccccacgtcggaacggtggtatcatgggcatctgtctggt
aaggaggctgagaagttgctgatggagaaagggcgtccaggcagcttcctggttcgggag
agtcagagcaaacctggggactttgtgctgtcagtgctcacacagcagctggacagggtg
gaccgccagccgcgtgtcacccacatcatgatccacttccagccagatgggaagtacgac
gtgggaggtggtgagcagttcgacacccttggagatctggtggagcgctacaggaagaac
cccatggtggagaggtcaggggttgtggtgcatcttcggcagcccctcaaggccacgaga
atcagcgctgcaagcattgagagccgtgtgcaggagctcagcgaggccacggatgccagc
gagaaggccaagcagggcttctgggaggagttcgagatgctgcagcagcaggaatgccgg
ctcctgtacccccggaaggaaggccagcggccggagaacaagcccaagaatcgatacaag
aacatccttccctttgataccactcgtgtcatccttcatgatgtggatgacagagtgcct
ggagccgactacatcaatgccaactacatcaggagtgacccagaggagaagccaggccat
ggactgggcaaggtgtacatcgccacccagggctgtctgccgactacagtggctgctttc
tgggccatggtgcaccaggagaacacacatgtcatcgtcatgaccaccagggaggtggag
cgaggccggaacaagtgtttccgatactggccagagctgcacggcagccaagagtacggc
caccttcacgtgtgcaacatggctgagcactgggcccagggctattgtgtgcgggagctg
caggtgtggaggccagaccaggaggagtcgccacacacagtgaaacactaccagtacttc
agttggccggaccacggcgtcccggccgagcccaccggcgtccttagcttcctggaagag
gtgaaccggacccacagcagcatgccgggggccggacccatggtagtccattgcagcgct
ggcatcggacgcactggcaccatcattgtgattgacatcctggtggacgtcattcgcagg
caggggttagactgcgacatcgacgtccccaagacgatccaactggtgcggcggcagcgc
tcggggatggtgcagaccgaggcgcagtacaagttcgtgtacctagcgctgcagcggtac
atcccgaggacccgggaggccccccgccacgaatatgagaacctgcagggcctagagccg
tga

KEGG   Bos indicus (zebu cattle): 109570927
Entry
109570927         CDS       T04792                                 

Gene name
PTPN11
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 11
  KO
K07293  tyrosine-protein phosphatase non-receptor type 11 [EC:3.1.3.48]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu04014  Ras signaling pathway
biu04072  Phospholipase D signaling pathway
biu04360  Axon guidance
biu04625  C-type lectin receptor signaling pathway
biu04630  JAK-STAT signaling pathway
biu04650  Natural killer cell mediated cytotoxicity
biu04670  Leukocyte transendothelial migration
biu04722  Neurotrophin signaling pathway
biu04920  Adipocytokine signaling pathway
biu04931  Insulin resistance
biu05168  Herpes simplex virus 1 infection
biu05205  Proteoglycans in cancer
biu05211  Renal cell carcinoma
biu05220  Chronic myeloid leukemia
biu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:biu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    109570927 (PTPN11)
   04630 JAK-STAT signaling pathway
    109570927 (PTPN11)
   04072 Phospholipase D signaling pathway
    109570927 (PTPN11)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109570927 (PTPN11)
   04650 Natural killer cell mediated cytotoxicity
    109570927 (PTPN11)
   04670 Leukocyte transendothelial migration
    109570927 (PTPN11)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    109570927 (PTPN11)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    109570927 (PTPN11)
  09158 Development and regeneration
   04360 Axon guidance
    109570927 (PTPN11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    109570927 (PTPN11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    109570927 (PTPN11)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    109570927 (PTPN11)
   05211 Renal cell carcinoma
    109570927 (PTPN11)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    109570927 (PTPN11)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    109570927 (PTPN11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:biu01009]
    109570927 (PTPN11)
Enzymes [BR:biu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     109570927 (PTPN11)
Protein phosphatases and associated proteins [BR:biu01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    109570927 (PTPN11)
SSDB
Motif
Pfam: Y_phosphatase SH2 DSPc Y_phosphatase3 PTPlike_phytase
Other DBs
NCBI-GeneID: 109570927
NCBI-ProteinID: XP_019832613
UniProt: A0A6P5D3C7
LinkDB
Position
17
AA seq 633 aa
MVLAALQHGCGDSGGNHRSKKSHFSCNGVESSALFFIALFLSLSRWFHPNITGVEAENLL
LTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY
YMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRES
QSHPGDFVLSVRTGDDKGESNDAKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKN
PMVETLGTVLQLKQPLNTTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECK
LLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNN
SKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEY
GVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLE
EVHHKQESIVDAGPVVVHCSAGIGRTGTFIVIDILIDIIREKGVDCDIDVPKTIQMVRSQ
RSGMVQTEAQYRFIYMAVQHYIETLQRRIEEEQKSKRKGHEYTNIKYSLTDQASGDQSPL
PPCTPTPSCAEMREDNARVYENVGLMQQQKSFR
NT seq 1902 nt   +upstreamnt  +downstreamnt
atggtcctagctgctctgcagcatggctgtggggactcaggtgggaaccacagatcaaag
aaatcgcattttagctgcaatggtgtggaaagcagtgctttgtttttcattgctcttttt
ctctccctctcaagatggtttcacccaaatatcactggcgtggaggcagaaaacctactg
ttgacaagaggagttgacggcagtttcttggcgaggcccagtaaaagcaaccctggagac
ttcacactttccgttagaagaaatggagctgtcacccacatcaagattcagaacactggt
gattactatgacctgtacggaggagagaaatttgccactttggctgaattggtccagtat
tacatggaacatcatgggcaactaaaagaaaagaatggagatgttattgagctcaaatat
cctctgaactgtgccgatcctacctctgaaaggtggtttcatggacacctctctgggaaa
gaagcagaaaaattattaactgaaaaaggaaaacatggtagctttcttgtgcgcgagagc
cagagccaccctggagattttgttctctctgtccgaactggagatgacaaaggggagagc
aatgatgccaagtctaaagtgacccacgtcatgattcgctgtcaggaactgaaatatgat
gttggtggaggagagcggtttgattctttgacagacctcgtggagcattacaagaagaat
cctatggtagaaacattgggcacagtactacaactcaagcagcccctcaacacaactcgt
atcaatgctgctgaaatagaaagtcgggttcgagaactaagcaaattagctgagaccaca
gataaagtcaaacaaggcttttgggaagaatttgagacactacaacaacaggagtgtaaa
cttctctatagccgaaaagagggtcagaggcaagaaaataaaaacaaaaatagatataag
aacatcctgcccttcgatcacaccagggtcgtcctccatgacggtgatcccaatgagccc
gtttcggattacatcaacgcaaacattatcatgcctgaatttgaaaccaaatgcaacaac
tcaaagcccaaaaagagttacattgccacacaaggctgcctgcagaacaccgtgaatgac
ttctggaggatggtgttccaagagaactcccgagtgattgtcatgacaacgaaagaagtg
gagagagggaagagtaaatgtgtcaaatactggcctgacgagtatgcactaaaagaatac
ggagtcatgcgcgttaggaacgtcaaggaaagtgccgctcacgactatacgttaagagaa
cttaaactctcgaaggttggacaagggaatacggagagaacggtctggcaataccacttt
cggacctggccggaccacggtgtgcccagtgacccggggggcgtgctggacttcctggag
gaggttcaccacaagcaggagagcattgtggacgcggggcccgtggtggttcactgcagt
gctggaattggccggacagggacgttcattgtgattgatattcttattgacatcatcaga
gagaaaggtgttgactgtgacatcgacgttcccaaaaccattcagatggtgcggtcacag
aggtcagggatggtccagacagaagcacagtaccgattcatctatatggccgtccagcat
tatattgaaacactacagcgcaggattgaagaagagcagaaaagcaagaggaaaggacac
gaatacacaaatattaagtattccctgacggaccaggcaagtggagatcagagtcccctg
ccaccttgtaccccaacaccatcctgtgcagaaatgagagaagataatgccagagtctat
gaaaatgtgggcctgatgcagcagcagaaaagtttcagatga

DBGET integrated database retrieval system