KEGG   Bos indicus (zebu cattle): 109570359Help
Entry
109570359         CDS       T04792                                 

Gene name
SPSB1
Definition
(RefSeq) SPRY domain-containing SOCS box protein 1 isoform X1
  KO
K13937  hexose-6-phosphate dehydrogenase [EC:1.1.1.47 3.1.1.31]
Organism
biu  Bos indicus (zebu cattle)
Pathway
biu00030  Pentose phosphate pathway
biu01100  Metabolic pathways
biu01200  Carbon metabolism
Module
biu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:biu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    109570359 (SPSB1)
Enzymes [BR:biu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     109570359 (SPSB1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     109570359 (SPSB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucosamine_iso G6PD_C G6PD_N DUF5617
Motif
Other DBs
NCBI-GeneID: 109570359
NCBI-ProteinID: XP_019831803
LinkDB All DBs
Position
16
AA seq 804 aa AA seqDB search
MLAEPHFKRRPGVWKMLMAXMCVALLSGLQAQDLPRQVSIILLGATGDLARKYLWQGLFH
LYLEEVGKGHHFRFHGTALTSTEQGQEVIAKVLESLSCPGDMASGHCAELKAQFQQLSEY
RQLKTPEDYLALSKDIEAQVEHEGLRETGRIFYLSVPPFAYVDIARNINSSCRPGPGAWL
RVVLEKPFGHDLHSAQQLATELGSFFQEEEMYRVDHYLGKQVVAQILPFRDQNRAALDGL
WNRHHVERVEIVMKETLDAEGRTSFYEEYGVIRDVLQNHLTEVLTLVAMELPVNVSSPES
VLQHKLQAFQALRSLQRHSAVLGQYQAYSGQVRRELQKPDSFHSLTPTFAGILVHIDNLR
WEGVPFILMSGKALDERVSYVRILFKNQAFCVQSEKHWVAAQSRCLPRQIIFYIGHGELG
SPAVLVSRNLFQPALPSASWKEVEGRPGLHLFGLPLSDYYAYSPVREQDAYSLLISHIFH
CRKDSFVTTENLLASWVFWTPLLDSLAHEVPRFYPGGAENGQLLDFEFSGGHLSFSQPLP
EQLVPGPDSAPLPSDFQVLRAKYRESPLISAWPEELIARLAGDIEAAAVRAVRRFGKFHL
AJSGGSSPVALFQQLATGHYSFPWAHTHLWLVDERCVPLWDPESNFQGLQTHLLQHVRVP
HYNVHPMPVHRRQRLCAEEDQGAQAYAEEISALVTNGSFDLVLLGMGTDGHTASLFPQSP
AGLDGEQLVVLTTSPSSPHRRMSLSLPLINRARKVAVLVMGRMKREIAMLVSRVGXDPKK
WPISGVLPDSGQLVWYMDYDAFLG
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgttagcagagccgcactttaaaaggcgcccaggcgtctggaagatgctcatggcgrct
atgtgcgtggccctgctcagcggcttgcaagcccaggatctccccagacaggtctccatc
atcctgctgggagccaccggggacctggccagaaagtacctgtggcagggcctgttccat
ctgtacttggaggaggtggggaagggccaccattttcgcttccacgggactgccctgacg
agcaccgagcagggccaggaggtcatcgccaaggtcctggagtccctgtcctgccctggg
gatatggcctcgggtcactgtgctgaactaaaggctcagttccagcagctgagtgagtac
cgccagctgaagacgcccgaggactacctggccctgagcaaggacattgaggcccaggtt
gagcacgaaggcctccgggagaccggccgaattttctacctctcggtgccgccctttgcc
tacgtggacatcgcccgcaatatcaacagcagctgccggccaggccccggtgcctggctg
cgcgttgtgctcgagaaaccctttggccatgacctccactccgcccaacagctggccaca
gaactggggagctttttccaggaagaggagatgtaccgggtggaccattacctgggcaag
caggtagtggcccagatcctgcctttccgagaccagaaccgtgcagccctggatggcctc
tggaaccggcaccacgtggagcgggtggagatcgtcatgaaggagacactggacgcggaa
ggccgcaccagcttctacgaggagtacggcgtcatccgagacgtcctgcagaaccacctg
acggaggtcctcacactggtggccatggagctgcccgtcaatgtcagcagcccagagtcc
gtgctgcagcacaagctccaggccttccaggcgctgcggagcctgcagaggcacagtgct
gtgctgggccagtatcaggcctacagcgggcaggtgcgcagggagctgcagaagccagac
agcttccacagcctgacgccaaccttcgcaggcatcctcgttcacatagacaacctccgc
tgggagggtgtcccgttcatcctgatgtcgggcaaagccttggacgagagagtgagctac
gtgcggatcttgttcaagaaccaggcgttctgcgtccagagcgagaagcattgggtcgct
gcccagagccgctgcctgccccggcagatcatcttctacatcggccacggcgagctgggc
agycctgccgtgctggtcagcaggaacctcttccagccggccctgccctccgccagctgg
aaggaagtggagggccggcccgggctgcacctcttcggtctcccactctcygattactat
gcctacagccctgtgcgggagcaggacgcctactccttgctcatctctcacatcttccac
tgccggaaggactcctttgtcaccacggagaacctgctggcctcctgggtcttctggacg
cccttgctggacagcctggcccacgaggtcccacgcttctacccaggaggagcagagaay
ggacagctgttggactttgagttcagcggcggccacctgtccttctcccagccactgccg
gagcagctggtgccggggccggactctgctccgctgcccagtgacttccaggtcctcagg
gccaagtaccgagagagcccgctgatctcggcctggccygaggagctgatcgccaggctg
gcrggtgacatcgaggccgctgctgtgcgggctgtgcggcgctttggcaagttccacctg
gctmtctcgggtggctcgagcccggtggccctgttccagcagctggccacagggcactac
agcttcccctgggcccacacgcacctgtggctggtggacgagcgctgcgtgcctctctgg
gaccccgagtccaacttccagggcctgcagacgcacctgctgcagcacgtgcgggtcccc
cactacaacgtccaccccatgcccgtgcaccggcgccagcggctctgtgcygaggaggac
cagggcgcccaggcctatgccgaggagatctccgcccttgtgaccaacggcagcttcgac
ctggtgctgctgggcatgggaactgacgggcacacggcctccctcttcccgcagtcgccc
gccggcctggacggcgagcagctggtagtgctgaccacgagcccctccagcccgcaccgg
cgcatgagcctcagcctgcccctcatcaaccgtgcccggaaggtggccgtgctggtcatg
ggcaggatgaagcgtgaaattgccatgctggtcagccgcgtgggccrtgaccccaagaag
tggcccatctcgggtgtcctgccggactctggccagctcgtgtggtacatggattatgat
gcgtttctggggtga

DBGET integrated database retrieval system